KEGG   Mus musculus (mouse): 108655Help
Entry
108655            CDS       T01002                                 

Gene name
Foxp1, 3110052D19Rik, 4932443N09Rik, AI461938, AW494214
Definition
(RefSeq) forkhead box P1
  KO
K23582  forkhead box protein P1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108655 (Foxp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    108655 (Foxp1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    108655 (Foxp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXP-CC Forkhead
Motif
Other DBs
NCBI-GeneID: 108655
NCBI-ProteinID: NP_444432
MGI: 1914004
Ensembl: ENSMUSG00000030067
Vega: OTTMUSG00000022717
UniProt: P58462
Position
6; 6 D3
AA seq 705 aa AA seqDB search
MMQESGSETKSNGSAIQNGSSGGNHLLECGALRDTRSNGEAPAVDLGAADLAHVQQQQQQ
ALQVARQLLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVSGLKSPKRNDKQ
PALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQLQEFYKKQQ
EQLQLQLLQQQHAGKQPKEQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQP
ALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTSSNHSSLDLTSTCVSSSAPSKSSLIMN
PHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCDDFPAFLKHLNSEHA
LDDRSTAQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLS
KSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADI
AQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNA
VRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAA
LQASMAENSIPLYTTASMGNPTLGSLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHP
IHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagaatctgggtctgagacaaaaagtaacggatcagccatccagaacgggtcc
agcggtggcaaccacttactagagtgcggggcacttcgtgacactcggtccaacggagag
gcaccagcggtggacctgggggcagccgaccttgcccacgtccagcagcagcaacagcag
gccctgcaggtggcaaggcagctcctccttcagcagcagcaacagcagcagcagcaacag
cagcagcagcagcagcagcaacagcagcaacagcagcagcaacaacagcagcagcagcaa
cagcagcagcagcagcagcaagttagtggattaaagtctcccaagaggaatgacaagcaa
ccagctcttcaggttcccgtgtcagtggctatgatgacacctcaggttatcactcctcaa
caaatgcagcagatcctccagcagcaggtgctgagcccccagcagctccaggttctcctc
cagcagcagcaggccctcatgcttcaacagcagcttcaagaattttataaaaaacaacag
gaacagttgcagcttcaacttctccaacagcaacatgctggaaaacagccgaaagagcag
caggtggctacccagcagttggctttccagcagcagcttctccagatgcagcagctgcag
cagcagcacctcttgtctctccagcgccaaggcctcctaacaattcagccggggcagcct
gcccttcccctccaacccctcgctcaaggcatgattccaacggaactgcagcagctctgg
aaagaagtgacaagtgcccacactgcagaggaaaccacaagcagcaaccacagcagccta
gacctgaccagcacatgtgtctcgtcctcggcaccttccaagtcctccctaatcatgaac
ccgcatgcctctaccaatggacagctctcggtccacactcccaaaagggaaagcttgtcc
cacgaggagcacccccacagccaccctctctatggacatggcgtatgcaagtggccaggc
tgtgaggcggtttgtgacgacttcccagcctttctaaaacatctcaacagtgagcatgcg
ctggacgatagaagcacagctcaatgtagagtacaaatgcaggttgtacagcagttagag
ctacagcttgcaaaagacaaagagcgcctgcaagccatgatgacccacctgcatgtgaag
tctacagaacccaaagctgcccctcagcccctgaatctggtatcaagtgtcaccctctcc
aagtctgcctcagaggcttctccacagagcttacctcatactccaacaacccccaccgcc
cccctgactcctgtcacccaaggcccctccgtcatcaccaccaccagcatgcacacggtg
ggacctatccgcaggcggtactcagacaaatacaacgtgcccatttcttcagcagatatt
gcgcagaaccaagaattttataagaacgcggaagttagaccaccatttacatatgcatct
ttaatcaggcaggccattctcgaatctccagaaaagcagctaacactaaacgaaatctat
aactggttcacacgaatgtttgcttacttccgacgcaatgcagccacgtggaagaatgca
gtgcgtcataatcttagtctccacaagtgttttgtgcgagtagagaacgttaaaggggca
gtatggacagtggatgaagtagagttccaaaaacggaggccacaaaagatcagtggtaac
ccttcccttattaaaaacatgcagagcagccacgcctactgcacacctctcaatgcagct
ttacaggcttccatggctgagaatagtatacctctgtacactaccgcttccatgggaaat
cccactctgggcagcctggccagtgccatccgggaggagctgaacggggccatggagcac
accaacagcaacgagagtgacagcagtccaggcagatcccctatgcaagctgtgcacccc
atacacgtcaaagaagaacccctcgaccccgaggaagctgaaggccctctgtccttagtg
acaacagccaaccacagtccagattttgaccatgacagagattacgaagacgaaccagta
aatgaggacatggagtga

DBGET integrated database retrieval system