KEGG   Mus musculus (house mouse): 108657
Entry
108657            CDS       T01002                                 
Symbol
Rnpepl1, 1110014H17Rik, AI894167
Name
(RefSeq) arginyl aminopeptidase (aminopeptidase B)-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    108657 (Rnpepl1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-
     108657 (Rnpepl1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M1
   108657 (Rnpepl1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 108657
NCBI-ProteinID: NP_852070
MGI: 1914170
Ensembl: ENSMUSG00000026269
UniProt: G5E872
Position
1:92837697..92848307
AA seq 720 aa
MAAQCCCRKAPGAEAAPARPPPEPPPALDVASASSAQLFRLRHLQLGLELRPEARELAGC
LVLELCALRPAPRALVLDAHPALRLHSVSFRRASAVSESPCTFAFPAPGSGPPLPGFADA
PGAESASCPLAFRLDPFTDYGSSLTVTLPPEVQAHQPFQVILRYTSTDAPAIWWLDPELT
YGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPLGVQVLMSATQSVYVEEEGL
YHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERL
YGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDVIHEVAHSWFGNAVT
NATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQMRLLGEDSPVSKLQV
KLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLD
SFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPL
EQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRW
LQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNL
RRTIQQILSQGLGPSAEPSTEPSTDLGGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcggcgcagtgctgctgccgcaaggcgcccggcgccgaagccgcgcccgcccgcccg
ccgccggagccgccgcccgccctggacgtggcctcggcctccagcgcgcagctcttccgc
ctccgccacctgcagctgggcctggagctgcggcccgaggcgcgtgagctggccggctgc
ctggtgctggaactgtgcgcgctgcggcccgcgccccgcgcgctcgtgctcgacgcgcac
ccggccttgcgcctacactcggtctcgtttcgccgcgcctccgccgtctccgagtcgccg
tgcaccttcgccttccctgccccggggtcggggcccccgctgcccggcttcgccgatgcg
cctggagcggagtctgccagctgcccgctggccttcaggctggacccgttcaccgactat
ggctcctctctgaccgtcacactgcctcccgaggtgcaggcgcaccagcccttccaggtc
atcctacgctacacctcgaccgacgccccggccatctggtggctggacccggagctgacc
tatggcaatgccaagccattcgtcttcacccagggacactctgtgtgcaaccgctccttc
ttcccgtgcttcgatacgccggcggtcaagtgcacctactcagccgttgtcaaggccccc
ttaggggtacaggtgctgatgagtgcaacccagagcgtgtacgtggaagaggaaggcctc
taccacttccacatggagcacccagtacccgcctacctcgtagcccttgtggccggagac
ctcaagccagcagacattgggcccaggagccgtgtgtgggctgagccatgcctcctgccc
acagccaccagcaagctatcaggtgcagtggaacagtggctgagtgcagcagagcgatta
tatggaccatacatgtggggcagatatgacatcgtcttcctgccgccctccttccccatc
gtggccatggagaacccctgcctcaccttcatcatctcctccatccttgagagtgacgag
ttcctggtgattgatgtcatccatgaggtagcccacagctggttcggcaatgctgtcacc
aacgctacttgggaggagatgtggctgagtgagggcctggccacctatgcacagcgccgc
atcaccacggagacctatggggctgccttcacctgcctagagacagccttccgcttggat
gccctgcataggcagatgcggcttcttggggaagatagtccggttagcaagttgcaggtc
aagctagaaccaggcgtgaatcctagtcacctgatgaacctgttcacctatgagaagggc
tactgcttcgtgtactacctgtcccagctctgtggcggtccccagcgctttgacgacttt
ctccgagcctatgtggagaaatacaagttcaccagtgtggtggcccaggacctgctggat
tccttcctgagcttcttccctgaactgaaggagcagagcgtggactgccgggcagggctg
gagttcgagcgctggctcaatgccacaggcccaccactggctgagccagacctgtcacag
gggtccagcctaacccggcctgtggaagcccttttccagctgtggactgcagagcccctg
gagcaggcggcagcttcagccagtgccattgacatctccaaatggaggaccttccagaca
gcactcttcctggaccggctgctagatggatccccgttgcctcaggaggtggtgatgagc
ctgtccaagtgctactcatccctgctggactccatgaacgctgagatccgcatccgctgg
ctgcagatcgttgtccgcaatgactactatcctgatcttcacagggtccgccgtttcctg
gaaagccagatgtcgcgcatgtacaccatcccactgtacgaggacctctgcactggtgcc
ctcaagtccttcgctctagaggtcttctaccaaacccagggccggctgcatcccaacttg
cgcagaaccatccagcagatcctgtcccaggggctaggccccagtgcggagccgagtaca
gagcccagcacggacctgggcggtgctgaggcagacacgaacccagactcgccagccctg
ctgctcggggacgaggcccccagcagcaccatctctctcagggacgtcaatgtgtctgcc
tag

DBGET integrated database retrieval system