KEGG   Mus musculus (mouse): 108664
Entry
108664            CDS       T01002                                 

Gene name
Atp6v1h, 0710001F19Rik, AU022349, CGI-11, SFD, SFDalpha, SFDbeta, VMA13
Definition
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit H
  KO
K02144  V-type H+-transporting ATPase subunit H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108664 (Atp6v1h)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    108664 (Atp6v1h)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108664 (Atp6v1h)
   04142 Lysosome
    108664 (Atp6v1h)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    108664 (Atp6v1h)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108664 (Atp6v1h)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108664 (Atp6v1h)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108664 (Atp6v1h)
SSDB
Motif
Pfam: V-ATPase_H_N V-ATPase_H_C Arm Arm_2 HEAT DUF2326 UCH
Other DBs
NCBI-GeneID: 108664
NCBI-ProteinID: NP_598587
MGI: 1914864
Ensembl: ENSMUSG00000033793
Vega: OTTMUSG00000050145
UniProt: Q8BVE3
Position
1; 1 A1
AA seq 483 aa
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSE
DKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKS
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTISSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELK
SGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAA
ARS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaccaagatggacattcgaggtgctgtggatgctgctgtcccaactaacatcattgcg
gccaaggctgctgaagttcgtgccaacaaagtgaactggcagtcttatcttcaggggcag
atgatttctgctgaagattgtgaatttattcaaaggtttgaaatgaaaagaagttccgag
gacaagcaagagatgcttcaaactgaaggcagccagtgtgctaaaacatttataaatctg
atgacgcacatctccaaagaacagacagtgcagtacatactaaccatggttgacgatatg
ctgcaggaaaatcaccagcgtgtcagcattttctttgactatgcgaaacgaagcaagagc
actgcctggccatacttcctgccaatgttgaatcgccaggatccctttactgttcatatg
gcagcaagaattatcgccaagttagctgcttgggggaaagaactgatggaaggcagtgac
ttaaattactatttcaattggataaaaactcagctgagttcacagaaacttcgtggcagc
ggtgttgctgttgaaacaggaacaatctcttcaagtgatagttctcagtatgtgcagtgt
gttgctggctgtctgcagctgatgctccgggtcaatgagtaccggtttgcctgggtagaa
gcagatggagtgaactgtataatgggcgttttgagtaacaagtgtggttttcaacttcaa
taccaaatgattttttcaatatggctcctggcattcagtcctcaaatgtgtgagcacctt
cgtcgctataatatcattcctgttctatcagacatccttcaagaatctgtcaaagagaaa
gtaacaagaatcattcttgcagcattccggaatttcttagaaaaatcaacggaaagagaa
actcgccaagagtatgctctggctatgattcaatgcaaagtactgaaacagttggagaat
ttggagcagcagaagtatgatgatgaagatatcagtgaagacatcaaatttcttttggaa
aaacttggtgagagtgtccaggaccttagctcatttgatgaatacagttcagaacttaaa
tctggaagattggaatggagccctgtacacaagtctgagaaattttggagagaaaatgcc
gtgaggttgaatgagaagaactatgaactcttgaaaatcttgacaaaacttctggaggta
tcagatgatccacaagtcttagctgttgctgctcacgatgttggagaatatgtccggcat
tatccccggggaaaacgggttattgagcagcttggtggaaagcagttggtgatgaaccac
atgcaccatgaagaccagcaggttcgctacaatgctcttctggccgtgcagaagctcatg
gtgcacaactgggaatatcttggtaaacaactacagtcagagcagcctcagactgctgct
gctcggagctga

DBGET integrated database retrieval system