KEGG   Mus musculus (mouse): 108679Help
Entry
108679            CDS       T01002                                 

Gene name
Cops8, 9430009J09Rik, AA408242, Csn8, Sgn8
Definition
(RefSeq) COP9 signalosome subunit 8
  KO
K12181  COP9 signalosome complex subunit 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    108679 (Cops8)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    108679 (Cops8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN8_PSD8_EIF3K PCI
Motif
Other DBs
NCBI-GeneID: 108679
NCBI-ProteinID: NP_598566
MGI: 1915363
Ensembl: ENSMUSG00000034432
Vega: OTTMUSG00000048401
UniProt: Q8VBV7
Position
1; 1 D
AA seq 209 aa AA seqDB search
MPVAVMADNAFSFRKLLDQCENQELEAPGGIATPPVYGQLLALYLLQNDMNNARYLWKRI
PPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFAL
VSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTRMVLPRKPASGTLDVSLNRFI
PLSEPAPVPPIPNEQQLARLTDYVAFLEN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggcggtgatggcggacaacgccttcagtttcagaaagctgttggatcagtgc
gagaaccaggaactcgaggctcctggaggaattgccacaccgccagtgtacggtcagctt
ctagctttgtacttgctccagaacgacatgaataatgcaagatatctgtggaagaggata
ccacctgctataaagtctgcaaattctgaacttgggggaatttggtcagttggacagcga
atctggcaaagagatttccctgggatctatacaaccatcaacgcccaccagtggtcagag
actgtgcagccaatcatggaagcccttagagatgcaacaaggagacgcgcctttgccctg
gtctctcaagcttatacctccatcatcgcagatgattttgcagcgtttgttggacttcct
gtggaagaggctgtgaaaggcgtgttggaacaaggatggcaggccgactccaccacaaga
atggttcttcccaggaagccagcctcaggaaccctggatgtctccttgaacaggtttatc
cccttatcagagcctgccccagttccgccaatccccaatgagcagcagctcgcccggctc
accgattatgtggctttcctggaaaactga

DBGET integrated database retrieval system