KEGG   Mus musculus (mouse): 108682Help
Entry
108682            CDS       T01002                                 

Gene name
Gpt2, 4631422C05Rik, ALT2, AU014768, AU041193, C87201
Definition
(RefSeq) glutamic pyruvate transaminase (alanine aminotransferase) 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108682 (Gpt2)
   00220 Arginine biosynthesis
    108682 (Gpt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    108682 (Gpt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     108682 (Gpt2)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class I
   108682 (Gpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 108682
NCBI-ProteinID: NP_776291
MGI: 1915391
Ensembl: ENSMUSG00000031700
Vega: OTTMUSG00000023224
UniProt: Q8BGT5
Position
8; 8 C3
AA seq 522 aa AA seqDB search
MQRAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPERSPRDRILTLESMNPQVKAV
EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPN
LLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNI
YLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCW
ALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEV
YQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHP
EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTE
DLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPG
SGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQYS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcagcggtgctggtgcggcggggctcctgcccccgcgcctcgggcccctgg
ggccgtagtcacagcagcgctgcagccgaagcctcggcggcgctcaaggtgcgaccggag
cgcagccctcgagaccgcatcctcaccctggagtccatgaacccgcaggtgaaggcggtg
gagtacgctgtgcggggacccatcgtgctcaaagccggcgagatcgagatggagctgcag
cggggtatcaaaaaaccattcactgaggtaatccgagccaacattggggatgcccatgct
atgggccagcagccaatcaccttcctccgtcaggtgatggcactctgcacctacccaaac
ctactaaacagccccagcttcccagaagacgctaagaaacgagcgcggcggatcctgcag
gcttgtggtggaaacagcttgggatcttacagtgctagccaaggcgttaactgtatccgt
gaagatgtggcagcctttatcaccaggagagatggtgtgcctgcagacccagacaacatt
tacctgactactggagctagcgacggtatttctacaatcctgaagctcctggtctccggt
ggtggcaagtcacggaccggcgtgatgattcccatcccccagtatcccttgtactccgcg
gtcatctctgagctcgacgcggtgcaggtcaactactatctggatgaagagaactgctgg
gctttgaatgtggacgagctccggcgggcattgcggcaagccaaagaccactgtgaccct
aaagttctctgcattatcaaccccggaaaccccacaggccaggtacaaagcagaaagtgc
atagaagatgtgattcactttgcctgggaagagaagctttttctcctggctgatgaggtg
taccaggacaacgtgtactctccagactgcagattccactcgtttaagaaagtgctttac
cagatggggcacgagtactccagcaacgtggagctcgcctccttccactccacctccaag
ggctacatgggcgagtgtggctacagagggggctacatggaggtgatcaatttgcacccc
gagatcaaaggccagctggtgaagctactctcggttcgcctctgtccgccagtgtcagga
caggccgccatggacattgttgtgaatccaccggaaccaggagaggagtcctttgagcaa
ttcagcagggaaaaagaattcgtccttggtaatctggccaaaaaagcaaagctgacagaa
gatctgtttaaccaagtcccagggatccagtgcaaccccttgcaaggagctatgtatgcg
ttccctcggattctcatccctgccaaggccgtggaggcagctcagtcccataaaatggct
ccagacatgttctactgcatgaagctcctggaggagactggcatctgtgtcgtgcctggc
agtggctttgggcagcgagaaggcacttaccacttcagaatgaccattctccctccggtg
gataaactgaagaccgtgctccacaaggtgaaagactttcacctgaagttcctggagcag
tactcatga

DBGET integrated database retrieval system