KEGG   Mus musculus (mouse): 108687
Entry
108687            CDS       T01002                                 

Gene name
Edem2, 9530090G24Rik, AI327354
Definition
(RefSeq) ER degradation enhancer, mannosidase alpha-like 2
  KO
K10085  ER degradation enhancer, mannosidase alpha-like 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108687 (Edem2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    108687 (Edem2)
Lectins [BR:mmu04091]
 M-type lectins
  108687 (Edem2)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 108687
NCBI-ProteinID: NP_663512
MGI: 1915540
Ensembl: ENSMUSG00000038312
Vega: OTTMUSG00000016134
UniProt: Q8BJT9
Position
2; 2 H1
AA seq 577 aa
MPFRLLIPLGLVCVLLPLHHGAPGPDGTAPDPAHYRERVKAMFYHAYDSYLENAFPYDEL
RPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDNVDFDIDVNASVFETNI
RVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLH
GVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHID
VLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTHFDDWYLWV
QMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYT
VEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK
LDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDSVMTPHGECILGAGGYIFNTEAHPI
DPAALHCCRRLKEEQWEVEDLIKEFYSLKQSRPKRAQRKTVRSGPWEPQSGPATLSSPAN
QPREKQPAQQRTPLLSCPSQPFTSKLALLGQVFLDSS
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcctttccggctactcatcccgctcggcctcgtgtgcgtgctgctacccctgcaccat
ggtgcgccaggccccgacggcaccgcgcccgaccccgcccactacagggagcgagtcaag
gccatgttctaccacgcctacgacagttacctggaaaatgcctttccctacgatgagctg
agacctctcacctgtgatgggcacgacacctggggcagtttttctctgacgctaattgat
gccctggacaccttgctgattttggggaatacctctgaattccaaagagtagtggaggtt
cttcaggacaatgtggactttgatatcgacgtgaacgcctctgtgttcgaaaccaacatc
cgagtggtaggaggactcctttctgctcatctcttgtcaaagaaggccggtgtggaggtg
gaagccgggtggccttgttctgggcctctcctcaggatggcggaggaagcagcccggaaa
ctcctcccagcatttcagacccccacgggcatgccctatggaactgtgaacctgcttcat
ggcgtgaaccctggagagacccctgttacctgtacagcagggattgggaccttcattgtg
gaatttgctaccctgagcagcctcaccggtgaccctgtgtttgaagatgtggccagagtg
gccctgatgcgtctctgggagagccggtcagatatcgggctggttggcaatcacatcgat
gtgctcactggcaagtgggtggcccaggatgcaggcatcggggctggtgtggattcctat
tttgagtacctggtaaaaggagccatccttcttcaggataagaaactcatggccatgttc
ctagagtacaacaaagccatccggaattacacgcacttcgatgactggtacctctgggtg
cagatgtacaaggggaccgtgtcaatgcctgtcttccagtccttggaggcctactggcct
ggccttcagagccttattggagacattgacaatgccatgaggacctttctcaactactac
actgtatggaagcagtttggggggctgccagaattctacaacattcctcagggatacaca
gtggagaagcgagaaggctacccactccgaccggagctcatcgagagcgcaatgtacctc
taccgcgccactggggatcccactctcttagaacttgggagagacgctgtggaatccatt
gagaaaatcagcaaggtggagtgtggatttgccacgatcaaggacctccgggaccacaag
cttgacaaccgcatggagtctttcttcctggctgaaactgtgaaatacctctatcttctg
ttccacccaaacaacttcatccacaacaatggctccacctttgactctgtgatgactccc
catggggagtgcatcctaggagccgggggctacatcttcaacacggaggctcaccccatt
gaccctgctgccttgcactgctgccggaggctcaaggaggagcagtgggaagtggaggac
ttgataaaggagttctactccctcaaacagagcaggccaaagagagctcagaggaagaca
gtgaggtcggggccctgggagccccagtcagggccagccacgctctcctcacctgcaaac
cagcccagggagaagcagcctgcccagcagcgaaccccgcttctcagctgccccagccag
cccttcacctctaagctggcattgctaggccaggttttcctagactcctcatag

KEGG   Mus musculus (mouse): 192193
Entry
192193            CDS       T01002                                 

Gene name
Edem1, A130059K23Rik, EDEM, mKIAA0212
Definition
(RefSeq) ER degradation enhancer, mannosidase alpha-like 1
  KO
K10084  ER degradation enhancer, mannosidase alpha-like 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    192193 (Edem1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    192193 (Edem1)
Lectins [BR:mmu04091]
 M-type lectins
  192193 (Edem1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 192193
NCBI-ProteinID: NP_619618
MGI: 2180139
Ensembl: ENSMUSG00000030104
Vega: OTTMUSG00000056450
UniProt: Q925U4
Position
6; 6 E2
AA seq 652 aa
MQWRALVLGLVLLRLGLHAVLWLVFGLGPSMGFYQRFPLSFGFQRLRDPDGSGPVGPPGG
PAWLHRPRRGTEGRLETPPEPGPTPGPGVCGPAHWGYALGGGGCGPDEYERRYSGAFPPQ
LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLNINDVLGNYSLT
LVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSK
QPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAG
AGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGL
GAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNVNM
FSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDV
LFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDR
MESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKRLRELPWKEFFSEDGER
DQEEKFVHRPKSQELRVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcaatggcgagcgcttgtcctggggctggtgctgctgcgcctcggcctccacgcggtg
ctctggttggtcttcgggctggggcccagcatgggcttctaccagcggtttccgctcagc
ttcggcttccagcgcttgagggaccccgacggctcggggccagttggtccgcccggaggc
ccggcctggcttcatcggccaaggcgcggaacggaggggcggcttgagaccccgccagag
ccgggaccgacgccgggaccgggcgtgtgcggcccggcgcactggggctatgccctgggc
ggcggtggctgcggcccggacgagtacgagcggcgctacagcggcgccttcccgccgcag
ctgcgtgcccagatgcgcgacctggcgcggggcatgttcgtcttcggctatgacaactac
atggcgcacgcctttccgcaggacgagctcaaccccatctactgccgcggccgggggcct
gaccgcggagacccttccaatctgaacatcaatgatgtcctagggaattactctctgact
ctggttgatgccttggatacattggcaataatgggaaattcatccgagttccagaaggca
gtcaagttagtgatcaacactgtttcatttgacaaagattccacagtccaggtcttcgaa
gctacgataagggttctgggaagcctcctttctgctcacagaataataactgattccaaa
cagccctttggtgacatgacaattgaggattatgataatgaattgttgtacatggcccat
gacttggctgtgcggctccttccagcctttgaaaacaccaagacagggatcccctatcct
cgggtgaatctgaagacaggtgttcctcctgacagcaataatgagacctgcacagcgggg
gccggttctctcctggtggaatttgggattctgagccgactgctgggggattccactttt
gagtgggttgccagacgagctgtgaaagccctctggaacttgcggagcaacgatacagga
ttattaggcaatgttgtgaacatccagacaggccattgggttggaaagcagagtggcttg
ggtgctgggctggattccttctatgagtacctcttgaaatcttacattctttttggagaa
aaagaagatctagagatgtttaatgctgcgtatcagagcatccagagctacctgcgaaga
ggccgggaagcctgcaatgaaggagaaggagacccaccgctctacgtcaacgtgaacatg
ttcagtgggcagctcatgaacacctggattgactcgctgcaggctttcttccctggactg
caggttctgataggggatgtggaagatgccatctgcctacacgccttctactatgccata
tggaagcggtacggggccctccctgagcgctataactggcaactccaggcccctgatgtt
ctcttctaccctctgagaccagagctagtggagtccacatatctcctctaccaggcaacc
aagaatcccttctacctccatgtaggaatggacattctgcagagtcttgaaaaatacaca
aaagtcaaatgtggatatgctacgctgcatcacgtcatagacaagtctaaagaagaccgg
atggaaagcttctttctcagcgagacttgcaaatacttgtatctgctatttgatgaagag
aatccagtacacaaatctggaaccagatacatgtttacaactgagggccatatcatatct
gtggacaaacgtcttcgggaattgccttggaaggaattcttctctgaagatggggagcgg
gaccaagaggaaaagtttgtacacagacctaagtctcaggagctcagagtcattaactcc
agttctaattgtaatcgtgttcctgatgagaggagatactccttgcccttaaagagcatc
tacatgcgccagatcgaccagatggttggcttgatttga

KEGG   Mus musculus (mouse): 66967
Entry
66967             CDS       T01002                                 

Gene name
Edem3, 2310050N11Rik
Definition
(RefSeq) ER degradation enhancer, mannosidase alpha-like 3
  KO
K10086  ER degradation enhancer, mannosidase alpha-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66967 (Edem3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    66967 (Edem3)
Lectins [BR:mmu04091]
 M-type lectins
  66967 (Edem3)
SSDB
Motif
Pfam: Glyco_hydro_47 PA Glyco_hydro_127
Other DBs
NCBI-GeneID: 66967
NCBI-ProteinID: NP_001034733
MGI: 1914217
Ensembl: ENSMUSG00000043019
Vega: OTTMUSG00000049645
UniProt: Q2HXL6
Position
1; 1 G2
AA seq 931 aa
MSKAGGCRGCGCRVPQRASWSLVAATAALCLVLATSVCTAGAAPMSREEKQKLGNQVLEM
FDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNK
TKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQWYNDEL
LHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAAL
SRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYL
LKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQ
VLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGD
PYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKED
IIFDIEDYIFTTEAHLLPLWLSTTNRSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDP
LYAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSL
IHLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIISHPFFG
RVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEK
ARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAI
REHEQVEVLLSDKARDRDPEMENEDQPSSENDSQNQSAEQMLSLSQTVDLADKESPEHPA
DSHSEASPSDSEEAAGFAPSEQISGSTENHETTSLDGECTDLDNQVQEQSETEEDSSPNV
SWGTKAQPIDSILADWNEDIEAFEMMEKDEL
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgagcaaagccggcggctgccggggctgtgggtgccgggtcccccagcgagcgtcatgg
agcctggtggcagcgacggccgcgctctgtctggtgttggccacgtccgtgtgcacggca
ggggccgcgcccatgagtagggaagagaagcagaagcttggaaatcaagtcctggaaatg
tttgatcatgcttatggcaactatatggaacatgcctacccagctgatgagctcatgcct
ttaacctgccggggccgtgtcagaggccaggagcccagccggggcgatgtggatgacgcc
ttgggaaagttttccctaacactgattgattctttggacactcttgtggtattaaacaaa
actaaggaatttgaagatgctgtgagaaaagttttaagggatgttaatttagataatgat
gtagttgtttcagtcttcgaaacaaacatcagagttcttgggggtcttttgggcggacac
tcgctggccatcatgctgaaggagaaaggcgagcacatgcagtggtacaatgacgagctc
ctccacatggcaaagcagctgggttacaagctcctgccagctttcaacaccaccagcggc
cttccgtaccccaggattaatttaaagtttggcatcagaaaaccagaagccaggacggga
acagagacagacacctgtacagcctgtgcaggcaccttgatcctcgagtttgctgcactg
agtcgattcacaggagcgaccatatttgaggaatatgcaagaaaagctcttgattttctc
tgggagaaaagacagcgaagtagcaatttagtaggcgtgactatcaatattcatactgga
gactgggtacgcaaagatagtggagttggagcggggatcgactcctattatgagtatctg
ttgaaagcctatgtcttgcttggagatgacagttttctggaaagatttaatacacattac
gatgccataatgaggtatataagccagccacctctcctacttgatgtgcatatccacaaa
ccaatgctgaacgctcggacctggatggatgcattgcttgccttttttccaggtttgcag
gttttaaagggtgatattagacctgctattgaaactcacgaaatgttataccaggtgatt
aaaaaacacaattttctaccagaggcatttactacagatttcagggtccattgggctcag
catcctttaaggccagagtttgcagaaagtacctacttcttatataaggctacaggagac
ccttactaccttgaagtagggaaaacacttattgaaaatttgaataagtatgctcgagtg
ccttgcgggtttgctgccatgaaggatgttcgcactgggagtcatgaggacagaatggat
tcattcttcttggctgaaatgtttaaatacctgtacctgttatttgctgataaagaggac
atcatttttgacatagaagactatatctttacaacagaagctcatctgttaccgctttgg
ctttccaccacaaaccgaagcatctcaaagaagaacacaacctcagaatacacagaactg
gatgatagtaattttgattggacttgtccaaacactcagattctttttcctaatgatcca
ttgtatgctcagagcatccgtgaacccttgaaaaacgtggtggataagagctgtccgaga
ggcatcatcagagtagaggagagtttcagaagtggagctaagcctcctctgagagccaga
gattttatggccactaaccctgaacatttagaaatcctgaagaagatgggggtgagtttg
attcacctcaaagatgggcgagtccagctggtccaacatgcaatccaagctgctagttca
attgatgctgaagatgggttacggttcatgcaggagatgatagagctgtccagtcagcaa
cagaaggagcagcagctgcctccacgagctgtccagattatctcccacccgttttttggc
agggtcgtcttaactgctggaccagctcagtttgggctggatctatctaaacacaaagag
acacgaggatttgttgcaagcagtaaaccatataatggttgttcagagctcactaaccct
gaggcagtgatgggaaaaattgccttgatacaaagaggacagtgcatgtttgcagaaaag
gcacgcaacattcagaatgctggcgccatcggtggcattgtgatcgatgacaacgagggg
agcagtagcgacacggcccccctgttccagatggccggcgatgggaaggacacagacgac
atcaagatccccatgctgttcctgttcagcaaggaaggcagcatcatcctggacgccatc
cgcgagcacgagcaggtggaggtgctcctttctgacaaagcgagagaccgagatcccgaa
atggaaaatgaagaccagccatcttctgaaaatgattctcagaatcagagcgcagagcag
atgctctcgctttctcagacagtcgacttggctgataaggagagccctgaacaccctgca
gattctcactcagaggcgtctccatcggacagtgaagaggctgctggctttgccccctct
gaacagatatctgggtccaccgaaaaccacgagactacaagccttgatggtgaatgtaca
gacttagataaccaagttcaagaacaatcagaaactgaggaagattccagtcctaatgtc
agctggggtacaaaggcccagcctatagactccatattagcagactggaatgaagacata
gaagcatttgaaatgatggagaaggatgaactatga

DBGET integrated database retrieval system