KEGG   Mus musculus (house mouse): 108689
Entry
108689            CDS       T01002                                 
Symbol
Stn1, 0610009H20Rik, 2310057J23Rik, AAF-44, AAF44, AI413458, Obfc1, RPA-32
Name
(RefSeq) STN1, CST complex subunit
  KO
K23312  CST complex subunit STN1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    108689 (Stn1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomere proteins
    CST complex (animals)
     108689 (Stn1)
SSDB
Motif
Pfam: STN1_2 tRNA_anti-codon Stn1 TBPIP
Other DBs
NCBI-GeneID: 108689
NCBI-ProteinID: NP_780569
MGI: 1915581
Ensembl: ENSMUSG00000042694
UniProt: Q8K2X3
Structure
Position
19:complement(47489470..47534284)
AA seq 378 aa
MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHP
IRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMT
SQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLEL
PKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELE
TVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKL
YYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLEL
LEDQSDIVSTADHYYAAF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgccacagccctgcctcttgatggagtgtgaatccagtccaagggaagaggagatcccg
cccctcttttggggtctggatcctgtgtttctagcctttgcaaaactctacatcaaggat
atcctggagatgaaggagtcccaacaagtgccaggtacatatttttacaacgggcatcca
ataaggcgggtagatatcatgggagctgtcatcagcgtgaaagaaagagagactttctac
agctacggagtggacgatgccactggggttataaactgcgtctgctggaagaagctgagc
aacgctgagtcttcctcagacccagctattctgagcactgcgagagagcttagcatgaca
tcacagcttaagaagctgcaggagaccatcgagcagaaaaccaggatagggattggagat
atcatccgagtccgaggctctgtgcgcatgttccgagaagagcgagagatctgtgccaac
atttattataaggtggacgatccagtgtggaacatgcaaatcgcaaggatgcttgagctg
cccaagctctaccagaaggtgtacgaccagcccttccgtaacccagccctacaggaggag
gaggcactaaacaataaagacaatttggatctcgctggcctcacgtctttgctgagtgag
aaaattaaagaattcctccaggagaagaaaatgcaaagcttctaccagcaggagttagag
acagtggagtctttgcagtctctggccagtcggcctgtgacccacagcacgggctcggac
caagtggagttaaaggacagtggcacttctggcgtagcgcagagagtgtttaagaatgct
ctccagctgcttcaggaaaaaggactcgtgttccagagagacagtggctctgataagctg
tactacgtaaccaccaaagacaaagacctgcagcagaagatctaccacatcattaaggaa
gactgtcagaaaccaaaccatatggagaagggctgccacctgctacacatcctgaactgt
gtgcacctcaacctccgctgggacctgagcaaggctgtgctgcagcgggtgctggagctc
ctggaggaccagagtgacatcgtcagcaccgcggaccactactacgcggccttctga

DBGET integrated database retrieval system