KEGG   Mus musculus (mouse): 108723
Entry
108723            CDS       T01002                                 

Gene name
Card11, 0610008L17Rik, 2410011D02Rik, BIM, BIMP3, CAR, CARMA1
Definition
(RefSeq) caspase recruitment domain family, member 11
  KO
K07367  caspase recruitment domain-containing protein 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108723 (Card11)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    108723 (Card11)
   04662 B cell receptor signaling pathway
    108723 (Card11)
SSDB
Motif
Pfam: CARD Guanylate_kin PDZ PDZ_6 DUF5930
Other DBs
NCBI-GeneID: 108723
NCBI-ProteinID: NP_780571
MGI: 1916978
Ensembl: ENSMUSG00000036526
Vega: OTTMUSG00000054841
UniProt: Q8CIS0
Structure
PDB: 
4I16

Position
5; 5 G2
AA seq 1154 aa
MPGGGPAMDDYMETLKDEEEALWDNVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQVKAKDLQRCELLAKSRQLEDEKKQLSLIRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPRKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDNGSLDQSLPRHLPATIISQNLGDTSPRTNGQEADDSSTS
EESPEDSKYFLPYHPPRRRMNLKGIQLQRAKSPISMKQASEFQVKGHEEDFTDGSPSSSR
SLPVTSSFSKMQPHRSRSSIMSITAEPPGNDSIVRRCKEDAPHRSTVEEDNDSCGFDALD
LDDENHERYSFGPPSIHSSSSSHQSEGLDAYDLEQVNLMLRKFSLERPFRPSVTSGGHVR
GTGPLVQHTTLNGDGLITQLTLLGGNARGSFIHSVKPGSLAERAGLREGHQLLLLEGCIR
GERQSVPLDACTKEEARWTIQRCSGLITLHYKVNHEGYRKLLKEMEDGLITSGDSFYIRL
NLNISSQLDACSMSLKCDDVVHVLDTMYQDRHEWLCARVDPFTDQDLDTGTIPSYSRAQQ
LLLVKLQRLVHRGNREEADSAHHTLRSLRNTLQPEEMLSTSDPRVSPRLSRASFFFGQLL
QFVSRSENKYKRMNSNERVRIISGSPLGSLSRSSLDATKLLTEKHEELDPENELSRNLTL
IPYSLVRAFHCERRRPVLFTPTMLAKTLVQKLLNSGGAMEFTICKSDIVTRDEFLRKQKT
ETIIYSREKNPNTFECIVPANIEAVAAKNKHCLLEAGIGCVRDLIKCKVYPIVLLIRVSE
KNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEAEMWSSVEELLRVLKDKIV
EEQRKTIWVDEDQL
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgccaggaggagggccagctatggatgactacatggagacgctgaaggatgaagaggag
gccctatgggataacgtggaatgcaaccggcacatgctgagccgttacatcaaccccgcc
aagctcaccccctacctgcgccagtgcaaggtcatcgatgagcaagatgaagacgaggtg
ctcaatgcgcccatgctgccgtccaagatcaaccgtgcaggccgattgttggacattctt
cacaccaagggacaaaggggctatgtggtcttcctggagagcctggagttttactaccca
gaactttacaaactggtgactggaaaggaacccacccggagattctccaccattgtggtg
gaggaaggccatgagggcctcacacacttcctgatgaacgaggtcatcaaactgcagcag
caagtgaaagccaaggaccttcagcgctgtgagctgctggccaagtcccggcaactggag
gatgagaagaagcagctgagcctgatacgggtggagctgctgaccttccaggagcgatac
tacaagatgaaggaggagcgggacagctacaatgacgagctcgtcaaggtcaaggacgac
aactacaacttagccatgcgctacgcccagctcagtgaggagaaaaacatggcggtgatg
aggagccgcgacctccaactcgagatcgaccagctcaaacaccgactgaacaagatggag
gaggaatgcaagctggagagaaatcagtccctcaagctcaagaatgacatcgagaaccgg
cccaggaaggagcaggtcctggagctggagcgggagaatgagatgctgaagacgaaaatt
caggagctgcagtccatcatccaggctggcaagcgcagcctccctgactcagacaaggcc
atcttggacatcctggaacatgaccggaaggaggcgctagaggaccggcaggaactggtc
aacaaaatttacaacctacaagaggaagtccgccaggcggaggagctgcgggataagtac
ctggaggagaaggaagacctggaactcaagtgttcaaccctggggaaggactgtgaaatg
tacaagcaccgcatgaacacagttatgctgcagctggaggaggtggagcgggagcgggac
caggccttccactcccgagatgaggcacagacacagtactcacagtgcttaatcgagaag
gacaagtaccggaagcagatccgggagctggaggagaagaacgatgagatgcgtattgag
atggtgaggagggaggcctgtattgtcaacctggaaagcaagctccggcgcctgtccaag
gacaacggcagcctcgaccagagtctgcctagacaccttccagccaccatcatctcacag
aaccttggagacaccagccccaggaccaatggccaggaagctgatgattcttcaacctca
gaagagtctcccgaagacagcaagtactttctgccttaccacccaccccggcgccggatg
aacctaaagggcatccagctgcagagagccaaatcccccatcagcatgaagcaagcatct
gagtttcaagtcaaggggcacgaagaggatttcacagacggcagccccagttcctcccgc
tcgctgcctgtcaccagctctttctccaagatgcaaccccatcggagccgcagcagcatc
atgtcaatcacggcagagcccccgggaaatgactccatagtcagacgctgtaaggaagat
gcgccacaccggagcacggtggaagaagacaacgatagctgtgggtttgatgccttagac
cttgacgatgaaaatcacgaacgttattcctttggacctccctccatccactcctcctcc
tcttcacaccagtcagagggactggatgcctacgacctggagcaggtcaacctcatgtta
cgaaagttctctttggaaaggcccttccggccatcggtcacatctgggggtcacgtgcgg
ggcaccgggcccttggtccagcacacaactctgaatggcgatgggctcatcacgcagctc
acccttctgggcggcaatgcacgcgggagcttcattcactctgtcaagccaggctcactg
gctgagagggccggactgcgtgagggccaccaactcctgctgctggaaggttgcatccga
ggcgaaaggcagagcgttccactggatgcgtgcacaaaagaagaggcccgttggaccatc
cagaggtgcagtggcctcatcactctgcattacaaggtcaaccatgaaggataccggaag
ctgctgaaggagatggaggatggtctgatcacatcaggggactcgttctatatccgcctg
aacctgaacatctccagccagctggatgcctgctccatgtccctcaagtgtgacgacgtg
gtgcatgtcctagacaccatgtaccaggacaggcacgagtggctgtgtgcacgagtcgac
cccttcactgaccaagacctggacacgggcaccatccccagctacagccgggctcaacag
cttctcctggtgaagctccagcggttggttcacagaggcaaccgggaagaggcagacagc
gctcaccacaccctgcgcagcctccggaacaccctgcagcccgaagagatgctttcgacg
agcgacccccgagtcagcccccgcctctccagagcgagtttcttctttggccagctcctg
cagtttgtcagccggtcagaaaacaagtacaaaagaatgaacagcaatgagcgcgtgaga
atcatctctgggagtcccctggggagcctctcccggtcctcgctggatgccaccaaactc
ctgaccgagaagcatgaagaactggatcctgagaatgagctcagccggaacctcaccctg
atcccttacagcctggtgcgcgctttccactgtgagcgccgcaggcctgtgctcttcacg
cccaccatgctggccaagacattggtgcagaagctgctcaactcagggggtgccatggag
ttcaccatctgcaagtcagatattgtcacaagagatgagttcctccgaaagcagaagaca
gagaccatcatctactcccgggaaaagaaccccaacacctttgaatgcatcgtccctgcc
aacattgaggctgtggcagccaagaacaaacactgcctgctggaggctgggatcggctgt
gtgcgcgacctgatcaagtgcaaggtgtaccccatagtgctgctcatccgggtgagcgag
aagaacatcaaacggttcaggaagctgctgccgcggccagagacggaagaggaattcctg
cgagtgtgcaggctcaaagagaaggagctggaggcgctgccctgcctctacgccaccgtg
gaagctgagatgtggagcagcgtggaggagctgctgcgagtcctcaaagacaagattgta
gaggagcagcgcaagaccatctgggtggacgaggaccagctgtga

DBGET integrated database retrieval system