KEGG   Mus musculus (mouse): 108829
Entry
108829            CDS       T01002                                 

Gene name
Jmjd1c, 5430433L24Rik, D630035I23Rik, Jmjdic, TR, TRIP8
Definition
(RefSeq) jumonji domain containing 1C
  KO
K11449  jumonji domain-containing protein 1C [EC:1.14.11.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108829 (Jmjd1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    108829 (Jmjd1c)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     108829 (Jmjd1c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    108829 (Jmjd1c)
SSDB
Motif
Pfam: JmjC zf-C5HC2 FYVE C1_2
Other DBs
NCBI-GeneID: 108829
NCBI-ProteinID: NP_001229325
MGI: 1918614
Ensembl: ENSMUSG00000037876
Vega: OTTMUSG00000037955
UniProt: Q69ZK6
Position
10; 10 B5.1
AA seq 2350 aa
MQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTF
LDDVVHSLLKGENIGITSRRRSRASQNISTVHGHYTRAQANSPRPAMNSQAAVPKQNTHQ
QQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGENPKGKNKHVVTKRRKPEEAEKRL
SMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEYEPKNKVTSKVNGEEGQSQAAEE
AGEETLIDTRPPWDQMQEDKNHNEGEKPKSTDSHLQDKMTLRSSEQATVADHNSNDSVLQ
ECNVENQRTVELLPKDRLVSRTPTPKCVTDIKNDTHSERAAQENLNTFGLQTPENMDPNV
SDSKHSNAKYLETAKQDCDQSWVSDVVKVDLTQSSVTNAPSGSDKRDTEKERNHYVSYMS
SLSAVSVTEDQLHKRSPPPETIKAKLTTSVDTQKAKSSSSPEVVKPKITHSPDSVKSKAA
YGNSQAVGERRLANKIEHELSRGSFHPVPTRGSALETTKSPLIIDKNEHFTVYRDPALIG
SETGANHISPFLSQHPFSLHSSSHRTCLNPGTHHPALTPGPHLLAGSTSQTPLPTINTHP
LTSGPHHPVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQS
PHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSP
SPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTKTLADHHKEELERK
AFMEPLRSNASTSVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQ
ESIDVAPFTTKIKGHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQS
LPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISSLSKPPPL
IKHQPESESLVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVF
HPPIHHSLERKESSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDSQSNFKNSSD
QSLTEMWRSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRV
CERSSSGANKTDYLKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNV
VSTTKADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAVAQAKDCT
VSTAVPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVRN
QTVAASLPLDSTMTCTASNKAISVGNGPAAQSSQPNYHTKLKKAWLTRHSEEDKNTNKME
NSGNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGSESG
DSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLKLQNS
NSAGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEESTHSP
VFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSKYILDII
GDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNVHWVCRKCGFVACL
DCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMLTQIIPGSVLTDLLDAMHILREKYGI
KSHCHCTNRQNLQGGNVPTMNGVSQVLQNVLHHSNKTSVSLPESQQQNSPQKSQTNGNSS
PGSASTDSRLTPPESQSPLHWLADLAEQKSREEKQENKEFTLEREIKEDGDQDASDSPNG
STSPPASQSNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGTSSGKGGRTMPNILD
DIIASVVENKIPPNKTSKINIKSEPNEEPKESSLPATDESNKSYRDIPHSWICDQHILWL
KDYKNSNNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIV
SNANVKEFWDGFEEVSKRQKNKGGETVVLKLKDCPSGEDFKAMMPTRYEDFLRCLPLPEY
CNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVAAAKDHDIGTTNLHIEASDVVNVLVYVG
IAKGNGVLSKAGILKKFEEEELDDVLRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKIS
KEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQFLGDAIVLPAGTLHQVQN
FHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDKLQVKNILYHAVKEMVRALKMH
EDEVEDMEDT
NT seq 7053 nt   +upstreamnt  +downstreamnt
atgcaaggtccttattcattaaatggatacagagtgagagtctatagacaagattctgcc
acccagtggtttactggcataattactcatcatgatctcttcacccgcaccatgatcgtt
atgaatgatcaggtactagaaccacagaatgtcgatccttctatggttcaaatgaccttt
ctagatgatgtcgttcactctttgttaaaaggtgaaaatattggcattacatcacggcga
aggtctcgtgccagtcaaaatatcagcactgttcacggtcattatacacgtgctcaagca
aatagtcccagaccagcaatgaactctcaagctgctgtaccaaaacagaacacacaccag
caacagcaacaaagaagtattcgtccaaataagaggaagggttcagatagcagcataccc
gatgaagagaagatgaaggaagataaatatgattgtgtatcacgaggagaaaatcctaaa
ggtaagaacaagcacgtggtgacaaaacggcggaaacctgaggaggccgagaagaggctg
agcatgaaaaggctccggacagacaatgcctctgacgcctccgagagcagtgacgcagag
agctccagcaagagagtgactgagacttcctcctctgaaccaatgccagagtatgaaccg
aaaaataaagtcacctcaaaggtaaatggagaggagggacagtcccaggctgctgaagag
gcaggagaagagaccctgatagatactcggcctccctgggaccagatgcaggaagataaa
aaccacaacgaaggggagaagcccaagtccacggacagccaccttcaagacaaaatgact
ctccgttcatctgagcaagccacagttgctgaccacaattctaatgattcagtccttcaa
gaatgcaatgtggaaaaccaacgcacagtggaattattaccaaaggacaggttagtgtcc
agaacaccgacacccaaatgtgttacggatatcaagaacgacactcattctgagagggcg
gctcaggaaaatttaaatacttttggcctccagacacctgagaacatggatccaaatgtt
agtgattccaaacattcaaatgctaaatacctagaaacagcaaagcaagattgtgaccag
agctgggtcagtgatgtagtgaaagtggatttaactcagtcaagtgttacaaatgctcct
tcaggaagtgataagcgcgatacggagaaagagagaaatcactatgtctcatacatgtct
tcattaagtgcagtttctgtcacagaggatcagctacataaacgaagtccacccccagaa
actataaaagctaaactaactacttcagtagatacccagaaggcaaaatccagttcttca
cctgaagttgttaaacccaagatcactcattctcctgattctgtgaagtctaaagctgct
tatgggaacagtcaagctgttggtgagcgaaggctggcaaataaaatagagcatgagtta
tccagaggtagtttccatccagttcctactcgaggcagtgctttggaaactacaaagagc
cctcttatcattgataaaaacgagcacttcacagtctatagggatcctgctcttattgga
tcagaaacaggagctaatcacatttcaccttttttgagccagcatcctttttctcttcat
tcctcatcccatagaacctgtttaaacccaggtacccatcaccctgccttaacgccagga
ccccacttactagctgggtcaactagtcaaactccattacctaccattaacactcaccct
ctcactagtggtccacaccatcctgtccatcaccctcatttgcttcccactgtgttacct
ggagtgcctactgcctctttactcggtggccacccacgtctagagagtgctcatgcaagc
agcttgagccatttagcactagcacaccagcagcagcaacagttgttacagcaccagtca
cctcatcttcttggacaagcccatccttccgcttcatataatcagcttggactttatcca
attatttggcaatatccgaatggaacacatgcatactcaggacttggtctcccttcttct
aagtgggttcacccagaaaatgcagttaatgctgaagcttcattaaggaggaattctccc
agtccttggctacatcaacccactcctgtgacctcagcggatggtattggattacttagt
cacattcctgtcagaccttccagtgcagagcctcatcgacctcacaagattacagtgcat
tccagtcccccactgacaaagacattagcagatcaccacaaagaagaattggagaggaaa
gcttttatggaaccattacggtctaatgcatccacatcagtaaaaggtgacctggatctt
aataggtcacaggcaggaaaagattgtcacttgcataggcattttgtgggtccaaggcca
ccccaggagactggagagagactgaacaaatacaaggaggaacatcgtcggattcttcag
gagagtattgatgtggctccatttacaaccaaaatcaagggtcatgaggttgaaagagag
aattactccagagtagtaccatcatcttctagtcctaaaagccatgctatcaaacaagat
aaagacgtagaccgctccgtgtcagagatttataagatgaagcactcagtgcctcagagt
ttgccccagagtaactacttcactactttatctaatagtgtggtcaatgagccaccaaga
tcctacccatccaaagaagtttccaacatttacactgagaaacaaaataataacctttct
gcaacagccaatcctcaaactcattcttttatatcatctctttcgaagcctccacctttg
attaaacaccaaccagaaagtgaaagtttagtgggcaagataccagaccatcttccccat
cagagtgcatctcactcagtaacaacgttcagaagtgattgtcggagccctacccatctg
actgtttcttctactaatgcactccgcagcatgcctgctctgcacagggcaccagtattc
catccaccaatccaccacagtttggaaagaaaggaaagcagctacagtagcctttcccct
ccaacactgacaccggtgatgccagtaaatgctggtggcaaagttcaagaatctcagaag
cctccaactctaattcctgagccaaaagactctcagtcaaattttaagaattcttctgat
cagagtctaacggaaatgtggagatctaataacaacctcaacagagagaaagctgagtgg
cccgtggaaaagagtagtggaaagtcccaggctgctgtggcatctgtcattgttcgtcca
ccttctagtacaaaagttgatagtgtgccatctgtaccattagcttccaaagatcgagtt
tgtgaaagatcttcatctggggcaaataaaacagattacctcaaaccagaagccggagag
actggaagaattattctaccaaatgtgaatttagaaagtgctcatgtgaaatctgaaaaa
aactttgaagctgtctcccagggcaacgttcctgtttcagtcatgtctgctgtaaatgta
gtctctactaccaaagcagatgtgttcacatctgctgccactaccaccagtgtctccagc
ttgagtagtgcagaaacaagttattctttatcaaataccatttcggcctctacacccttc
gaatgtacttcttcaaaaagtgttgttagtcaggcagtggcgcaagcaaaggactgcaca
gtcagcaccgcggttccaggcactctggcctgtagtaagacaggaagtgctgttcagccc
ggctctggcttctcaggcacaactgattttattcatttaaaaaagcacaaggcagcgttg
gctgcagctcagtttaaaaatagtagtgtcagtgaggctgaacttaatactgtgagaaat
cagacagtggcagcctctcttcccctggatagcaccatgacctgcactgcaagtaacaaa
gcaatctctgtaggaaatgggccagcagcccagtccagtcagcccaactaccacactaaa
ctgaagaaggcctggctcaccagacattcagaagaagataaaaatactaataaaatggaa
aattcagggaattctgtatccgaaattattaagccatgttctgtcaacttaatagcctct
acatctaatgatatagaaaatcgtgcagatggcagagtcgctgtagataaatatggaaga
gatgagaaagtcagcaggagaaaagccaaaagaacttacgaatctggctctgaaagtgga
gactcagatgagagcgaaagcaagtcggagcagaggactaaacggcagccgaagccaact
tataaaaagaagcagaacgacctgcagaagaggaaaggcgaggtcgaagaggactcgaag
cctaatggagttctcagcaggagcgccaaggacaaaagtaaactgaagttgcagaacagt
aatagcgctggcgttcctcgttccgtgctgaaagactggcggaaggtcaagaagctgaag
caaactggagaatcatttctgcaggatgactcctgctgtgagataggtcccaacttacag
aagtgccgagagtgcagacttatccggagtaagaagggggaagaatcaactcactcaccg
gtgttttgtagattttactactttaggagattgtcctttagtaagaatggagtagtcaga
atagatggtttctcttctcctgatcaatacgatgatgaagccatgagtttatggacccat
gaaaattatgaagatgatgaagtagatgttgaaacctctaagtatatcttggacataata
ggtgataagttctgtcagttagtaacgtctgagaaaacagcgttgtcctgggtgaaaaag
gatgccaaaattgcatggaaaagggcagttcgaggtgtccgggagatgtgtgatgcgtgc
gaggccacactgttcaacgtccactgggtttgccgcaagtgtggatttgtggcttgcttg
gactgttacaaggccaaggaaaggaagagttctagagataaagagctgtatgcttggatg
aagtgtgtgaaaggccagccccatgaccataagcatctgatgctgactcagattatccct
ggctctgtgttgacagaccttcttgatgccatgcacattcttagggaaaaatatggtatt
aaatcccattgtcactgtacaaacagacagaatttacaaggtggaaatgttcctacaatg
aatggtgtgtctcaagttctacagaatgttcttcaccacagtaataagacttctgtgtcc
ctgcctgagtctcagcagcagaacagccctcagaaatctcagactaacggcaacagtagc
cctggaagtgcaagtacagacagcaggttgacacctccagagtcccagtcaccgctgcac
tggctagctgatcttgctgagcagaaatccagagaggaaaaacaagaaaacaaagaattt
actcttgaaagggaaatcaaagaagatggagaccaagatgcctctgattctccaaatggc
agcacatcacctccagcatcccagagcaacgaacagggttcaaccctacgtgatttgctg
accacaacagctggcaagcttcgtgtgggctctacagatgctggcattgcctttgcgcca
gtatattcaatgggaacctcaagtggcaaaggtggccggactatgcctaacattcttgat
gacatcattgcttcagttgttgaaaacaaaattccaccaaataaaacctccaagatcaat
ataaaatcagaacctaatgaagaacccaaagaaagcagtctgcctgccacggatgaaagc
aataagtcttatcgtgacataccacattcttggatctgtgaccagcatattttatggctt
aaagattacaagaatagtaataactggaagcttttcaaagagtgctggaaacaaggacag
cctgcagtggtttccggtgtgcataagaaaatgaacattagcttgtggaaggcagaatca
attagtctggattttggagaccaccaagctgatctcctcaactgcaaagacagcattgtt
tccaatgccaacgttaaggagttctgggatggttttgaagaagtgtcaaaacgtcaaaaa
aacaaaggtggagaaacagtagtattaaagttgaaagactgcccatctggggaggacttc
aaggccatgatgccaacaagatatgaagactttttaagatgtctgccattaccagaatat
tgcaacccagaagggaagttcaatttggcctcccatttgccagggttctttgtacgccct
gatctaggacccaggctgtgcagtgcctatggtgttgctgctgctaaggatcatgatata
ggaaccacaaatcttcacattgaagcttctgatgttgtcaatgtcctagtctatgtcggc
atagcaaaaggaaatggcgtcctctcaaaagcaggaatacttaagaaatttgaagaagaa
gaattagatgatgttttaagaaaaagattaaaggattcgagtgaaatccctggtgctcta
tggcatatttatgctggaaaagatgttgacaagataagggaatttcttcaaaagatttca
aaagaacaaggccttgaagttctgccagagcatgatccaatccgggaccaaagctggtat
gtgaatagaaagctccgccagagactgcttgaggaatatggggtgagagcctgcactctg
attcagttccttggtgatgccattgttttgccagcaggaacacttcaccaggtacaaaat
tttcacagctgtgttcaggtgaccgaagactttgtctctccagaacatcttgtacagtcg
tttcacttaacacaggagctgaggcttttgaaggaagaaatcaattacgatgataaactc
caggttaagaatatcttgtatcatgcagtcaaggaaatggtgagagctctgaagatgcat
gaagatgaagtagaggatatggaagacacctaa

DBGET integrated database retrieval system