KEGG   Mus musculus (mouse): 108837
Entry
108837            CDS       T01002                                 

Symbol
Ibtk, 5430411K16Rik, AA409502, BTKI, mKIAA1417
Name
(RefSeq) inhibitor of Bruton agammaglobulinemia tyrosine kinase
  KO
K24810  inhibitor of Bruton tyrosine kinase
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    108837 (Ibtk)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  BTB-POZ domain-containing proteins
   108837 (Ibtk)
SSDB
Motif
Pfam: RCC1 BTB RCC1_2 Ank_5 Ank_4 Ank_2 Ank Ank_3 DUF3342
Other DBs
NCBI-GeneID: 108837
NCBI-ProteinID: NP_001074751
MGI: 1918677
Ensembl: ENSMUSG00000035941
Vega: OTTMUSG00000045033
UniProt: Q6ZPR6
Position
9; 9 E3.1
AA seq 1352 aa
MDAATPDCTSKCRSLKHALDVLSVVTKGSESQIKSFLARYCYNAATVKDAFGRNAGHLAS
SCGKKGVLDWLIEKGVDLLVKDKESGWTALHRSVFYGHIDCVWSLLKHGVSLYMQDKEGL
SPLDLLMKDRPTHVVFKDTDPTEVYTWGDNTNFTLGHGSQNSKHHPELLDLFSRSGVYVK
QVVLCKFHSVFLSQKGQVYTCGHGRGGRLGHGDEQTCLVPRLVEGLSGHNCSQVAAAKDH
TVVLTDDGCVYTFGLNMFHQLGIIPPPASCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWT
REAVYTLGLNGGQLGHLLDPNGEKCVTTPRQVSALHHKDIAVSLVAASDGATVCVTTRGD
IYLLADYQCKKMATKQLNLKKVLVSGGCMEYKVDPEHLTENGGQKICVLAMDGAGRVFCW
RSISSSLKQCRWAYPRQVSISDIALNRNEILFVTQDGEGFKGKWFEDKRKNSEKKADILP
NLHHSSSDVSCVPDTNSVYERIRLEKLPFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIP
VVSSSSFFEEFGKLLRETDEMDSFHDVTFQVGNRHFPAHKYILAVRSDFFQKLFLSDGSS
LELTDVYQKDEDAAGCHLFVVEKVHPDLFEYLLQFMYTDTCDLLTHGFKPRMIVKRKAED
CEGSPDSHLHTVNCHVDDKQKSAFEVYRSNQAHTLSERQKSKPKSSKKGKGVGDDDPVRM
LQSVAKKFGLSNLSSRLEGVRLENEKINVIAKKTGNKLKLSQKKCSFLYDVTMKSVDGKE
FSCHKCVLCARLEYFHSMLSRSWIEASSCAALEMPIQSEILKVILDYLYTDEAVVIKESQ
NVDFVCSVLVVADQLLITRLKEICEVALTENLTLKNAAMLLEFAALYNAGQLKLSCLQFI
GLNMAALLEARSLDVLSEDVLKDLSIFYRKMIPAMERRVITPYQDGPDISSMQVEDGEVF
FKEEINMEPNYSETMFKKAKTRAKKKPRKRSDSSGGYTLSDVIQSPPSAGLLKSAKTNSV
ESLPELLTSDSEGSYAGVASPRDLQSPDFTAGFHSDKVEGKAKPYVNGIPPPCTREDVKP
WEKSPTTKSAPQFIPSNRVDTAASSSWLAGSCSPVSPPVVDLRTIMETEENRQKYGAAPK
SNLGKIISHGIKLSQKQRKMIALTTKENNSGTNSMEAILTAPSKSPKPANAWAPLHSPLS
RSFRDFLLEEKKPVPGYGSGDHVKKVCFKGTENSPALNVARCSTHGTPGLESNHVSDFPL
LDSPNPWQSSSLAASPAVAPVTFASIVEEERQQEAALIRSREKPLALIQVEEHAIQDLLV
FYEAFGNPEEFVVVERAPQGPLAVPMWNKHGC
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggatgctgccacccccgactgcacgtcaaaatgcagatccctgaagcatgcgctggat
gtcctttctgtggtgacaaaggggagtgagagccagatcaagtccttcctcgccaggtac
tgctacaatgctgcaactgtcaaggatgcctttggcaggaacgccggccacctggcttcc
tcctgcgggaagaaaggagtgttggactggctgattgagaaaggagtggacttgctggtg
aaagacaaggagtccggctggacagcactgcacagaagcgttttttatggacatatcgat
tgtgtttggtctctgttgaagcatggtgttagcttgtatatgcaagataaagaaggattg
tcacctttggatcttcttatgaaggacaggccaactcatgttgtatttaaggacactgat
cccacagaagtctatacttggggagataacacaaacttcactctgggccacggaagccag
aatagcaaacatcaccccgagctgctggacctgttctccaggagtggggtttatgtcaag
caggtggtgctttgcaaatttcattcggtgtttctgtcccagaaagggcaggtttacacc
tgtggccatggtcgcggaggacggttaggccatggagatgaacagacatgcttggttccc
aggcttgtggaaggactgtctggtcacaattgttcgcaagtggcagctgctaaggatcac
actgttgtgttaactgatgatggatgtgtctatacatttggtctcaacatgtttcaccaa
ttaggaattattcctccacctgctagttgtaatgtacccagacagatacaggcaaaatat
ctgaaaggaaggactatcattggagtagcagcgggcaggtttcatacggtgctgtggact
cgagaagccgtttacacactgggactgaatggtggacagttgggtcacttactggatccc
aatggtgaaaagtgtgtcacaacccctcgccaagtctctgcccttcatcacaaggatatc
gctgtgtctttggtagctgcaagtgatggtgccacagtctgtgtcaccacaaggggagac
atttacttacttgcagactatcagtgcaagaagatggcaactaaacaactgaacttgaaa
aaggttcttgtctctggaggttgtatggaatacaaggttgatcctgaacatttgacagaa
aatggaggtcagaaaatatgtgtcctcgctatggatggagctggaagggtgttttgctgg
agatcaatcagcagttctctgaagcagtgccgatgggcctatcctcgccaggtgtcaatc
tccgatattgctttaaatagaaatgaaattctgtttgtcacacaggatggggaaggattt
aaagggaaatggtttgaagacaaaagaaagaattctgaaaagaaagcagacattttacca
aacctccatcattcctcatcagatgtgtcttgtgtccctgatacaaatagtgtgtatgaa
agaattcgacttgagaaacttccttttgcccatagagctgttagtgtcagcacagatcca
agtgggtgcaactttgcaatcctacagtcagaccctaaaacaagcctttatgagattcca
gttgtgtcttcatcatctttttttgaagaatttggcaagctcctgagggagacagatgaa
atggacagcttccacgatgtgacctttcaagttggcaatagacacttccccgcacataaa
tacattttggccgtgcgctctgacttcttccagaagttgtttctttcagatggctcttct
ttagagctgacggatgtttaccagaaagacgaagatgctgctggctgccatctctttgtg
gtggagaaagtccatcctgacttgttcgaatacctcttacagttcatgtacacagatacc
tgtgacttgttaactcatggcttcaaaccaagaatgatcgtgaagagaaaggcagaagac
tgtgagggctccccagattctcatctgcacactgtgaattgccatgtggatgataaacag
aagtcagcatttgaggtgtacagaagcaaccaggcccacacacttagtgaacggcagaag
agcaaacccaaatcttctaagaagggaaaaggtgttggggacgacgaccctgtaaggatg
ttgcaaagtgttgctaagaagtttggcctcagtaatttgagtagcaggttagaaggagtc
agattggaaaatgaaaaaattaatgttattgcgaagaaaactggcaataaactgaagcta
agtcagaaaaaatgttcgtttctgtatgatgtcaccatgaagtctgtggatggaaaggag
ttctcctgccataagtgtgtgctctgtgcgagacttgagtatttccacagcatgcttagc
agatcgtggattgaggcctccagctgtgcagctctggaaatgccaatccagtctgagatt
ctgaaagtgattttggactacctctacactgatgaggctgtggtgataaaagagtctcaa
aacgtggactttgtttgtagtgttcttgtcgtggctgatcagcttctcataactcggtta
aaggagatttgtgaagtagcattgactgaaaaccttacccttaagaatgctgcgatgctg
ctggagtttgcagccttgtacaatgctgggcagttgaagctctcttgtttacagttcata
ggactgaatatggcagctttacttgaagcaaggtctctggatgttttaagtgaggatgtt
ttgaaggacctttccatattctacagaaaaatgattccagcaatggagagaagagtcatt
acaccgtatcaagatgggccagatattagctctatgcaagtagaagacggagaggtcttt
tttaaagaagaaataaacatggaaccaaattactcggaaactatgttcaagaaggcgaaa
acaagagctaaaaagaagccacggaagcgctcagacagttcaggaggctacaccctttca
gatgttatccagagtccaccgtctgcaggattattaaagtctgcaaagaccaattctgtg
gagtctcttccagaattgttgacctcagattcggaaggaagctatgcaggagtggcgagt
cccagagacctccagtcgcccgacttcacagcaggattccattcggataaggtcgagggg
aaagctaagccatacgtgaatggtatacctcctccatgtactagggaagatgtaaagccg
tgggagaaatcaccaacaactaagtctgctccccagttcatccccagtaacagagtggac
actgcagcctcttccagttggcttgccggctcttgcagtcctgtgagtcctcctgttgtg
gatcttagaaccatcatggaaacagaagaaaacagacagaaatatggcgcagcaccaaag
tcaaacttaggaaagattatttctcacggaatcaaactttctcagaagcaacggaaaatg
attgcattgaccaccaaagaaaacaattcaggaacgaacagcatggaagccattttgaca
gctccttccaagtcccccaagcctgcgaatgcatgggcacctctgcactcacctttatcc
aggtcattccgggattttttactagaagaaaaaaaacccgttcctggctatggttcagga
gatcatgtcaaaaaagtttgttttaaaggaactgaaaactctccagccctaaatgttgca
agatgttcaacccatggaactccaggattagaaagcaatcatgtttctgattttccactt
ctagacagtcccaacccctggcagtcttcctccctggcggcttctcccgcagttgctcca
gtcacatttgcatccattgtagaagaagagcggcaacaagaagctgccctcatcagaagc
cgggagaaacccttggctctcattcaggtcgaggagcatgcaatacaagacttgctggtt
ttctatgaggcatttggcaaccccgaggagtttgtcgtcgttgaaagggcaccacagggg
cctctggcagtgcctatgtggaacaagcatggctgctag

DBGET integrated database retrieval system