KEGG   Mus musculus (mouse): 108841
Entry
108841            CDS       T01002                                 

Gene name
Rdh13, 8430425D21Rik
Definition
(RefSeq) retinol dehydrogenase 13 (all-trans and 9-cis)
  KO
K11161  retinol dehydrogenase 13 [EC:1.1.1.300]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108841 (Rdh13)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     108841 (Rdh13)
SSDB
Motif
Pfam: adh_short adh_short_C2 Epimerase KR Sacchrp_dh_NADP Polysacc_synt_2
Other DBs
NCBI-GeneID: 108841
NCBI-ProteinID: NP_780581
MGI: 1918732
Ensembl: ENSMUSG00000008435
Vega: OTTMUSG00000022761
UniProt: Q8CEE7
Position
7; 7 A1
AA seq 334 aa
MSRFLLPVSVVGTVIGGTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK
RGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDI
LVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAG
HIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRH
TGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEA
EDEEVARRLWTESARLVGLAMAHGSPGRGHAIPR
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagccgctttctgctgccggtgtccgtagtgggcacggtgatcggcggcaccgtgctg
ctcaaggactatgtcgctggtggggcttgtcccagcaaggccaccatacctgggaagact
gttatcgtgacaggagccaacacaggcatcgggaaacaaactgctttggagctggctaaa
agaggaggcaacgtcattctggcctgtcgtgacatggagaagtgcgaggtggctgcaaag
gacattcgaggagagaccttgaatccccgcgtacgtgctgaacgcctagacttggcttcc
ctcaagtccatccgagagtttgcaaggaaggtcattaaagaggaggagcgagtagacatt
ctggtcaacaacgcagccgtgatgcggtgcccacactggaccactgaggatggctttgag
atgcagtttggtgtcaactacttggggcattttctattgacaaatttgctgttggacaag
ctgaaggcctcggccccatcacgcatcatcaatctctcgtccctggctcacgttgctggg
cacatagacttcgaggacttgaactggcagatgaaaaagtatgacaccaaggcagcctac
tgccagagcaagttggctgttgtcctcttcaccaaggagctgagccaccggctgcaaggc
tctggtgtgacggtcaatgcactgcaccctggtgtggccaggacagagctggggcgacat
acgggcatgcacaactctgccttctctggcttcatgcttgggcccttcttctggctgctg
ttcaagagtccccagctggcggcccagcccagcacatatctggccgtggcagaagaactg
gagaatgtttcggggaagtactttgatggactcagagagaaggctccatctcctgaggct
gaagatgaggaagtagcccgcagactttggacggaaagtgcccgtttggtgggcttggcc
atggctcatggatcccctgggagaggacatgccattcccagataa

DBGET integrated database retrieval system