KEGG   Mus musculus (house mouse): 108897
Entry
108897            CDS       T01002                                 
Symbol
Aif1l, 2810003C17Rik, AI043124, C87647, Iba2
Name
(RefSeq) allograft inflammatory factor 1-like
  KO
K18617  allograft inflammatory factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    108897 (Aif1l)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     108897 (Aif1l)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8
Other DBs
NCBI-GeneID: 108897
NCBI-ProteinID: NP_660126
MGI: 1919598
Ensembl: ENSMUSG00000001864
Vega: OTTMUSG00000012243
UniProt: Q9EQX4
Position
2:31840315..31863454
AA seq 150 aa
MSVALSNRFQGGKAFGLLKARQEKRLEEINREFLCDQKYSDEENLPEKLAAFKEKYMEFD
LNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVL
KLVMMFEGKANESSPKPAGPPPERDIASLP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcggtcgcactcagcaacaggttccaaggagggaaggcgttcggtttgctcaaagcc
cggcaggagaagaggctcgaggagatcaatcgggagttcctctgtgaccagaagtacagt
gatgaagagaacctgccggaaaagctcgcagccttcaaagagaaatacatggagtttgac
ctgaataatgaaggcgagattgatctgatgtctttaaagaggatgatggagaagctgggg
gtccccaagacccacctggagatgaagaagatgatctcggaggtgacagggggtgtcagt
gacaccatctcctaccgagactttgtgaatatgatgctgggcaagcggtcggctgtcctc
aagctggtcatgatgtttgaaggaaaagccaacgagagcagcccgaagccagctggccca
cctccagagcgagacatcgccagcctgccttga

DBGET integrated database retrieval system