KEGG   Mus musculus (mouse): 108907Help
Entry
108907            CDS       T01002                                 

Gene name
Nusap1, 2610201A12Rik, AI481307, ANKT, AW547774, BB165529, BM037, LNP, NuSAP, Q0310, SAPL
Definition
(RefSeq) nucleolar and spindle associated protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: NUSAP
Motif
Other DBs
NCBI-GeneID: 108907
NCBI-ProteinID: NP_598612
MGI: 2675669
Ensembl: ENSMUSG00000027306
Vega: OTTMUSG00000015954
UniProt: Q9ERH4
Position
2; 2 E5
AA seq 427 aa AA seqDB search
MTVPSAEELDSFKYSDLQNLAKRLGLRANMKADKLLKALKAHLNPETRKENKNQDENQFS
TDETEIHVSSEEQAETESGGHVTKTRRRRRKKHKTIHGIPTSQTLLQDHLEMKGTDSSNF
QNQENQENQDPRDTAEVPSLPEQRPEDGNAASSGEGEVNDIKDSKKPLEKRSLCTDEFSK
LGNNKRTSATTPNFKKLHEARFKKMESIDEYIMRKKKHLKEHSSLNELKLDKKGIVTPVP
PRGRLSVPCTPARQQCPQGHSATKMNVRFSAATKDNEHKCSLTKTPARKSPHVTAPGSAS
KGQAVFRTPKSKATERTSIAVITPFKLMTEATQTPSSSKKPVFDLKASLSRPLNYKPHKG
KLKPWGQAKENNSLNERVSRVTFHRKTYKQPHLQTREERWKRQEQERKEKKEKLLEARRN
LGVTKAQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccctctgcagaggagctggactcctttaagtacagcgacctgcaaaattta
gccaaaaggctgggcctccgggctaacatgaaggcagacaagttgttaaaagccttgaaa
gcacacctgaatccagaaacaaggaaagaaaataaaaatcaggatgaaaatcaattctcc
actgatgaaactgagatacacgttagcagtgaggagcaagctgagacggaatcaggtggt
cacgtcaccaaaacgaggaggaggaggaggaagaagcacaagaccatccatggaattcct
acctcccagactttgttgcaggatcatttggagatgaaaggaactgatagtagtaacttc
caaaatcaagaaaatcaggaaaatcaagaccccagggatacagcagaagttccttctctg
ccggagcagaggccagaggacggcaatgcggcttcttcaggagaaggagaagtaaatgac
attaaagattcaaagaagcctttagaaaaaagatctctatgcacggatgagttttctaaa
cttgggaacaataaaaggacttcagccacaacaccaaactttaagaagcttcatgaggct
cgttttaagaaaatggaatccattgatgaatatattatgaggaaaaagaaacaccttaaa
gaacacagttcacttaatgaactaaagcttgacaaaaaagggatagtgaccccagttcct
ccaagaggaaggctctctgtaccctgtactcctgccaggcagcagtgcccacaaggccac
tcagcaactaaaatgaatgtcaggttttcagctgctactaaagacaatgaacataagtgc
tcactgaccaagacaccagccagaaagtctccacacgtgactgcacctgggagtgcttca
aaaggccaggctgtgttcaggacacccaagtcaaaggccactgaaaggacttctattgca
gttattacccctttcaagttgatgactgaagcaacacagactccaagttctagtaagaag
ccagtatttgatctcaaagcaagcttgtctcgtcccctcaactacaagccacacaaagga
aagctgaaaccttggggacaagctaaagagaacaattctctgaacgaacgtgtaagcaga
gttaccttccacaggaaaacttacaaacaacctcatctccaaaccagggaagaacgatgg
aagagacaagagcaagaacgaaaggagaagaaagaaaagcttttggaagctcgaagaaac
ctgggtgtgactaaagcccagtga

DBGET integrated database retrieval system