KEGG   Mus musculus (mouse): 108946
Entry
108946            CDS       T01002                                 

Gene name
Zzz3, 3110065C23Rik, 6430567E01Rik, AA408566, AI481057, AW556059, R75514
Definition
(RefSeq) zinc finger, ZZ domain containing 3
  KO
K24536  ZZ-type zinc finger-containing protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    108946 (Zzz3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     108946 (Zzz3)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 ZZ
Other DBs
NCBI-GeneID: 108946
NCBI-ProteinID: NP_001074224
MGI: 1920453
Ensembl: ENSMUSG00000039068
Vega: OTTMUSG00000017427
UniProt: Q6KAQ7
Position
3; 3 H3
AA seq 910 aa
MVGTCHSMAASRSTRVTRSTVGLNGLDESFCGRTLRNRSIAHPEEISSHSQVRSRSPKKR
AEPVPTQKGTNNGRTSDVRQQSARDSWVSPRKRRLSSSEKDDLERQALESCERRQAEPAP
PVFKNIKRCLRAEATNSSEEDSPVKPDKEPGEHRRIVVDHDADFQGAKRACRCLILDDCE
KREVKKVNVSEEGPLNAAVVEEITGYLTVNGVDDSDSAVINCDDCQPDGNTKQNNPGSCV
LQEESVAGDGDSETQTSVFCGSRKEDSCIDHFVPCTKSDVQVKLEDHKLVTACLPVERRN
QLTAESASGPVSEIQSSLRDSEEEVDVVGDSSASKEQCNENSSNPLDTGSERMPVSGEPE
LSSILDCVSAQMTSLSEPQEHRYTLRTSPRRAALARSSPTKTTSPYRENGQLEETNLSPQ
ETNTTVSDHVSESPTDPAEVPQDGKVLCCDSENYGSEGLSKPPSEARVNIGHLPSAKESA
SQHTAEEEDDDPDVYYFESDHVALKHNKDYQRLLQTIAVLEAQRSQAVQDLESLGKHQRE
ALKNPIGFVEKLQKKADIGLPYPQRVVQLPEIMWDQYTNSLGNFEREFKHRKRHTRRVKL
VFDKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEGSHNRPQMIRGRLCDDSKPETFNQ
LWTVEEQKKLEQLLLKYPPEEVESRRWQKIADELGNRTAKQVASRVQKYFIKLTKAGIPV
PGRTPNLYIYSRKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCLHSHMSTAA
EEASDEESIPIIYRSLPEYKELLQFKKLKKQKLQQMQAESGFVQHVGFKCDNCGVEPIQG
VRWHCQDCPPEMSLDFCDSCSDCPHETDIHKEDHQLEPVYKSETFLDRDYCVSQGTSYSY
LDPNYFPANR
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggtagggacttgccatagtatggctgcttcccgatctactcgtgttacaagatcaaca
gtggggttaaacggcttggatgaatctttttgtggtagaactttaaggaatcgtagcatt
gctcacccagaagaaatctcttctcattctcaagtacgatcaagatcaccaaagaagaga
gcagagcctgtgccaactcagaaaggaaccaataatggaagaacctctgatgtgagacag
cagagcgctcgagactcatgggtgagccctaggaaaagaagactttcttcttcggaaaag
gatgacctggaaaggcaggccctagagagttgtgagaggaggcaggcagagccagcacca
ccagtctttaagaacattaaacgctgtcttagagctgaagccacaaatagttcagaagaa
gattcgcctgtaaaaccagacaaggagccaggagaacacaggaggatagtagtggaccat
gatgcagactttcaaggggctaaacgagcttgtcgatgtcttatattggatgattgtgag
aaaagggaagttaaaaaggtgaatgtcagtgaggaagggccacttaatgctgcagtagta
gaagaaatcacaggctatttgactgtcaatggtgttgatgacagtgactcagctgttata
aactgtgatgactgtcagcctgacgggaacactaaacaaaataaccctggttcctgtgtg
ctgcaggaagaatcagtagctggagatggggattcggaaacccagacctcagtgttctgt
ggtagtaggaaggaggacagttgtatagaccatttcgtgccttgcacaaagtctgatgtg
caggtcaagttggaggaccacaaactagtaactgcctgcctacctgtggaacgacgaaat
cagctgactgccgagtcagcttcaggccctgtttctgaaattcagtcatccttaagagat
tctgaggaagaagtagatgtggtgggagatagcagtgcctccaaagagcagtgtaatgag
aacagcagtaaccccctggacacgggttctgaacgcatgccagtctctggagagccagag
ctgtcctctatcctagactgtgtttcagctcagatgacatctttatcagaacctcaggaa
catcggtacaccctgagaacttcacctcggagggcggccctggccagaagtagtcctact
aaaaccacatctccttacagagaaaatggacagttggaggagactaatctcagtccccag
gaaacaaacacgaccgttagtgatcatgtgagtgagtctcccacagatcctgccgaagtt
cctcaagatggaaaggttctatgttgtgactctgaaaactatggaagtgaaggactaagt
aagccaccctcagaggccagagtgaatattggacatttgccatctgccaaagagagtgcc
agtcagcacactgccgaggaggaagatgatgaccctgatgtttattactttgaatcagat
catgtggcactgaaacacaacaaagattatcagagactgctacagaccattgctgtactt
gaggctcagcgttcccaagcagtgcaagacctggaaagtttaggcaaacaccagagagaa
gcactaaaaaatcctattggatttgtggagaaacttcagaagaaggctgacatagggctt
ccatacccacagagagttgttcagttacctgagatcatgtgggaccagtacaccaatagc
cttgggaactttgaaagagaatttaaacaccgcaaaagacatactaggagagttaagtta
gtttttgataaagtagggttgcccgctagaccaaaaagtcctttagatcctaagaaggat
ggagaatccctttcgtactccatgttgcctttgagtgatggtccagaaggctcccataac
cgtcctcagatgataagaggtcgcctgtgtgacgacagcaagcccgagaccttcaaccag
ctgtggactgttgaagaacagaaaaaactcgaacagctactcctgaaataccctcccgaa
gaagtagaatctcggcggtggcagaagattgctgatgaactgggcaaccggacagccaaa
caggtcgccagtcgtgtacagaagtacttcataaagctaacgaaagccggcataccagtt
ccaggcagaacacctaacttatatatatactccagaaagtcctcaacaagcaggcgacag
cacccccttaataagcacctctttaaaccttccactttcatgacttcacatgagccaccg
gtgtacatggatgaagatgatgaccggtcctgtctccatagccacatgagcactgctgct
gaggaggcctcagatgaagaaagcattcctatcatatataggagtttacctgaatataaa
gaactattacagtttaaaaagttaaaaaagcagaaacttcaacaaatgcaagcagaaagt
gggtttgtgcagcacgtaggctttaagtgtgataactgtggtgtggaacctatccaagga
gtccggtggcactgccaggactgccctccagaaatgtctttggatttctgtgactcttgt
tcagactgcccacatgaaacagatattcacaaggaagaccaccagttagaacctgtttat
aagtcagagacgttcttagacagagattactgtgtgtcccagggcaccagttatagttat
ctggaccccaactacttcccagccaacagatga

DBGET integrated database retrieval system