KEGG   Mus musculus (mouse): 108958
Entry
108958            CDS       T01002                                 

Gene name
Miga2, 5730472N09Rik, AA408683, AI790341, C9orf54, Fam73b, R74766
Definition
(RefSeq) mitoguardin 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Miga
Other DBs
NCBI-GeneID: 108958
NCBI-ProteinID: NP_001229336
MGI: 1922035
Ensembl: ENSMUSG00000026858
Vega: OTTMUSG00000016796
UniProt: Q8BK03
Position
2; 2 B
AA seq 593 aa
MAFRRTEGMSMIQALAMTVAEIPVFLYTTFGQSAFSQLRLTPGLRKVLFATALGTVALAL
AAHQLKRRRRKKKQVGPEMGGEQLGTVPMPILMARKVPSVKKGCSSRRVQSPSSKSNDTL
SGISSIEPSKHSGSSHSLASMVVVNSSSPTAACSGSWEARGMEESVPTTDGSAESLYVQG
MELFEEALQKWEQALSVGQRGDGGSTPTPGDSLQNPDTASEALSEPESQRREFAEKLESL
LHRAYHLQEEFGSTFPSDSMLLDLERTLMLPLTEGSLRLRADDEDSLTSEDSFFSATEIF
ESLQIGEYPLPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAF
EGLLEERSNQIFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELE
GRGVACMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKA
KRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLRDMFDLDN
VRYTSVPALAEDILQLSRRRSEILLGYLGAPVASSIGLNGPLPRENGPLEELQ
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcattccggaggactgagggtatgtccatgatccaggctctggccatgactgtggct
gagattccagtgttcctgtacacaacttttggtcagtccgcgttctcccagctgcggttg
acaccgggcctgaggaaggttctttttgccacagcccttgggactgtggccttggccctg
gctgcccaccagctgaaaaggcgccggcggaagaagaagcaggtgggccctgagatggga
ggtgagcagctgggcacggtgcccatgcccatcctcatggcccgcaaggtcccttcggtg
aagaaaggctgctccagcaggagggttcagagccccagcagcaagagcaacgacactctt
agtggcatctcctccatcgagcccagcaagcactcaggctcctcccacagcctggcctcg
atggtagtggtcaattcatccagccctacagctgcgtgctcaggttcatgggaagcccga
gggatggaggagtctgtgcccaccactgatggcagtgccgagagcctctatgtgcaaggc
atggagctgtttgaggaagccctgcagaaatgggagcaggcactgagtgtgggccagaga
ggggatggaggcagcacccccacaccaggcgacagcctccagaacccagacaccgcatca
gaagcactgtcagagccagagtcccaacgaagggagtttgctgagaagctggagtccctg
ctgcaccgggcctaccacctgcaggaagagtttggctctaccttcccctctgacagcatg
ctgttggatcttgagaggaccctaatgctgccactgactgagggctcactgcgacttcga
gctgacgatgaggacagcctgacctctgaagactcctttttctcagccactgagatcttt
gagtccctgcagatcggcgagtacccgcttcctctctccaggcctgctgctgcctacgag
gaggctctgcagctggtgaaggaaggaagagtcccttgccgaacactcaggacagagctg
ctgggctgctacagtgaccaggacttcctagccaagctgcattgtgtacggcaggccttt
gaggggcttctagaagaaagaagcaaccagatcttctttggggaggtcggccggcagatg
gtgacgggcctgatgaccaaggctgagaagagtcccaaaggcttcctggagagctatgag
gagatgctgagctacgccctgcggcctgagacctgggctaccacccggctggagctggag
ggcagaggggtggcctgcatgagcttcttcgacatcgtgctggacttcatcctcatggat
gcctttgaggacctagagaaccctccgtcttcggtgcttgctgtcctgaggaaccgctgg
ctgtctgacagcttcaaagaaacagccctagccaccgcgtgctggtctgtcctgaaagcc
aagaggaggctcctgatggtgcctgatggcttcatctcccatttctactccgtatcggag
catgttagccctgtgttggcctttggcttcctcggacccaagccccagctctcggaagtc
tgtgctttcttcaagcaccagattgtacaatacctgagggacatgttcgacctggacaac
gtgcgctacacatctgtgccagccctagcagaagacatcctacagctgtcccggcggcgc
agcgagattctattgggctacctgggggcacctgtggctagtagcatcgggctgaatggg
ccactgcctcgagaaaatgggcccctggaagagctgcagtaa

DBGET integrated database retrieval system