KEGG   Mus musculus (mouse): 108960Help
Entry
108960            CDS       T01002                                 

Gene name
Irak2, 6330415L08Rik, AI649099, IRAK-2
Definition
(RefSeq) interleukin-1 receptor-associated kinase 2
  KO
K04731  interleukin-1 receptor-associated kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108960 (Irak2)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    108960 (Irak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    108960 (Irak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108960 (Irak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108960 (Irak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death
Motif
Other DBs
NCBI-GeneID: 108960
NCBI-ProteinID: NP_751893
MGI: 2429603
Ensembl: ENSMUSG00000060477
Vega: OTTMUSG00000023746
UniProt: Q8CFA1
Position
6 E3; 6 52.82 cM
AA seq 622 aa AA seqDB search
MACYIYQLPSWVLDDLCRNIDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWSMRQATVQQLVDLLCHLELYRAAQIVLSWKPVPESTSPLPAFPEAVKPGAVATSRR
NLKDEQEKVRPVKPRSLLDTGPIMAGAQRQRPCEMDAPCSLKTDAPDSPQSKYCSTSTSA
PKQERLLGLPGDRLFWSEADVVQATEDFDQSHRISEGTFADIYQGQRNGVAFAFKKLREV
AGSSPGSMDRFLQAEMQLCLRCCHANVLPLLGFCTGRQFHSLIYPYMANGSLHDRLWAQG
NSDMLPWPQRASICSGLLLAVEHLHSLDIIHSNVKSANVLLDQHLNPKLAHPVAHPHPDN
KKTKYTVMRTHLFQASAAYLPEHFIRVGQLTKQVDIFSCGIVLAEVLTGIPAMDKDRSPV
YLKDLLLSEIPNSTSSVCSRKTSMGKAVVKEICQRHVEKRAGLLPEACEEAWATAVSVCL
RRRNASVEEARVSLAGVEEQLRGQLSLPWSRVSEATGSSSNTPEETDDVDNSSLSVPSLV
MMASCPGAASSPLFTGHGAAQPSTSGRQEADSSSEACTGPQTPQNATETSWKIEINEAKR
RLMENIVLYKEERLDSSELFGP
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctacatctaccagctgccgtcctgggtgctggacgacctgtgccgcaatatc
gacacgctcagtgagtgggactggatgcagttcgcttcctacgtgatcacagacctgaca
cagctgaggaagatcaagtccatggagagggtccagggggtgagcatcacccgggagcta
ctgtggtggtggtccatgcggcaggccacggtccagcagctggtggacctcctgtgtcac
ctggaactctaccgagctgcccagattgtcttgagctggaagccggttcctgagagcaca
tctcccctcccagccttcccagaggctgtgaagccaggggctgtggctacttctagaaga
aacctcaaggatgaacaggagaaagtccggcctgtgaagccacgttcccttctagacaca
gggcccatcatggctggggcccagcggcagcgtccgtgcgagatggatgccccttgttcc
ctgaaaactgatgcacccgactctccccagtctaagtattgcagtacttccacatctgcc
cccaagcaagaaaggcttttgggtttgcccggagacaggcttttctggagtgaagcagat
gtcgtccaagcaactgaggactttgaccaaagccaccgaatcagcgagggcacctttgcc
gatatctaccagggtcaaaggaacggtgtggccttcgccttcaagaagctcagggaggtg
gccggctccagtccagggtccatggacagattcctacaggcagagatgcagctctgcctc
agatgctgccacgcgaacgtcctacctctgctgggtttctgcactggaagacagttccac
agcctcatctacccctacatggcaaatggctctctgcacgacagactctgggctcagggc
aactcagacatgctgccctggccacagcgggccagcatctgctcagggctgcttctagcc
gtggagcacctgcatagcctggacatcatccacagcaatgttaagagtgccaacgtcttg
ctggaccagcatcttaaccccaagctggctcatcctgtggctcaccctcatcccgacaat
aaaaagaccaaatataccgtcatgaggactcacctgttccaggcctcagctgcatatctg
ccggaacacttcatcagagtggggcagctgaccaagcaggtggacatcttcagctgtgga
attgtattggccgaggtccttaccggcatccctgcgatggacaaggaccgcagtccagtt
tacctgaaggatttgcttctcagtgagattcccaacagtacttcttcagtctgctccagg
aagaccagcatggggaaggcagtggtgaaagagatctgccagagacatgtggagaagagg
gcagggctgctgcctgaggcctgtgaggaagcctgggccaccgctgtgagtgtctgcctg
cggaggcgcaatgccagcgtggaggaggcacgagtctccctggccggggtggaggagcaa
ctccgagggcagctgtcccttccctggagcagggtttctgaggccacaggctcatcttcc
aataccccggaggaaacagatgacgttgacaattccagcctcagcgtcccttctttggtt
atgatggcatcgtgcccaggggctgcctcctctccactcttcacgggacatggagcagca
cagccatccaccagtgggagacaggaggctgactcctcgtcagaggcttgcacaggccca
cagacaccccagaacgctacagagacttcatggaaaattgagatcaatgaagccaaaagg
agactgatggagaacatcgtactctacaaagaagagagactggacagcagcgagctcttt
ggaccctga

DBGET integrated database retrieval system