KEGG   Mus musculus (house mouse): 108978
Entry
108978            CDS       T01002                                 
Symbol
4930555G01Rik
Name
(RefSeq) RIKEN cDNA 4930555G01 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Takusan MucB_RseB CATSPERE_Ig-like
Other DBs
NCBI-GeneID: 108978
NCBI-ProteinID: NP_780602
MGI: 1922055
UniProt: Q8C5Y7
Position
14:complement(17410530..17419144)
AA seq 205 aa
MFSRLLRLCLKGNGDEGETRPKKKEEGILSHEKGRRKLFWRRHRPARNTSTQNSNITNQI
SNINKVEELKLHIRKISNERKEMCEILNVYMYEDLNYRMNTEFNIIKSQHEKTMLDMNKM
TQSIIGSMQYSMELIEDNYSYSIKEDHLLRECTQLNKKVRILLNENRKLLVEQAGTQVSC
GEEKRFCEEASKNICASSAKEQQLP
NT seq 618 nt   +upstreamnt  +downstreamnt
atgttttccaggctgctcaggctatgtctgaaagggaatggcgatgaaggagagaccaga
ccaaaaaagaaggaagagggaatcctttctcatgaaaaaggaagaaggaaattgttctgg
agaaggcacaggcctgctagaaatacttcaacccaaaattccaacatcacaaatcagata
tcaaatataaataaagtagaagaactgaaattgcatataaggaagatcagcaatgagagg
aaggaaatgtgtgaaatcctgaatgtttacatgtatgaggatttaaactacaggatgaac
actgaattcaacataattaaatcacaacatgagaagacaatgttggatatgaataaaatg
acccagtccataattggttccatgcagtactccatggaactgatagaagataactattcc
tacagcattaaggaggaccacctcctccgtgagtgcactcaactcaacaaaaaagtaagg
atattactgaatgagaacagaaagctgctggtggagcaggctggaacgcaagtgtcctgt
ggggaagaaaagaggttctgtgaggaggccagcaagaacatctgtgcctcaagtgcaaag
gaacagcagcttccctaa

DBGET integrated database retrieval system