KEGG   Mus musculus (mouse): 109032
Entry
109032            CDS       T01002                                 

Gene name
Sp110, 5031415C07Rik, 52kD, 52kDa, 5830484A20Rik, I, Ifi, Ifi75, Ipr1
Definition
(RefSeq) Sp110 nuclear body protein
  KO
K24503  nuclear body protein Sp110
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    109032 (Sp110)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   SAND domain-containing proteins
    109032 (Sp110)
SSDB
Motif
Pfam: HSR SAND
Other DBs
NCBI-GeneID: 109032
NCBI-ProteinID: NP_084470
MGI: 1923364
Ensembl: ENSMUSG00000070034
Vega: OTTMUSG00000024589
UniProt: Q8BVK9
Structure
PDB: 
1UFN

Position
1; 1 C5
AA seq 445 aa
MFTLTKALEKALLQHFIYMKVNIAYAINKPFPFFEALRDNSFITERMYKESLEACQNLVP
LSKVVHNILTSLEQTFHPSVLLTLFSKVNLREYPSLVAIFRSFRNVGYTYEEKNRPPLTL
LEDLANPAEGCSLQTLLPPPRPQISLPSHLSSAPRVCDPRATAQPIIEILDEQPSPSPRA
VPLLGCIQEGKTTPVSSRDHQRKDKEDSREMPHSPSGPESVVKDDSPAANDLEMAREVPC
TPANKKARRKKRPNWSNSKRRRQKKKPRQDEMMGVASPGHGVQEKLKAVSRRTLWKDDSS
TNVKEVTKTQRTRMRRAQTSNSQEISKEASKTSGRKRPSTARRTTQVPEKTKNDAVDFSP
TLPVTCGKAKGTLFQEKLKQGASKKCIQNEAGDWLTVKEFLNEGGRATSKDWKGVIRCNG
ETLRHLEQKGLLFFTSKSKPQKKGA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgttcactctgaccaaagccttggaaaaggctcttctccagcatttcatatacatgaag
gtgaacatcgcctatgccatcaacaagccattccccttcttcgaagcgctccgggacaat
tccttcatcactgagagaatgtacaaggaatctctggaagcctgtcaaaatctggtccct
ctgtccaaagtggtgcacaatattctcaccagtctggagcagactttccacccgtcagtg
ctgctgacgttgttcagcaaggtcaacctccgggaataccccagcctggtggcaattttc
agaagcttcagaaacgttggttatacctacgaagagaaaaacagacccccactgaccctg
cttgaagacctggccaacccagcagaagggtgctcccttcagacactgctgccaccaccc
cgaccccagatatcgctgccaagtcatctgtcctcagcaccgagagtctgtgaccccaga
gcaaccgcacagccaatcattgagatcctggatgagcagcccagtccttctccccgagct
gtgcctctccttggctgcattcaggaaggaaaaaccactccagtgtcctccagagatcac
cagagaaaagataaggaagactctcgagagatgccccacagtccctcaggacccgagtca
gtggtaaaagatgactctccagcagcaaatgacctggaaatggccagggaagtaccctgc
acacctgcaaacaagaaagcaagaagaaaaaaacgtccgaactggtcaaattccaaaaga
agacggcagaaaaaaaagccccgtcaagatgagatgatgggagtggcctcacctggacat
ggagttcaagagaagctcaaggcagtgagcaggaggactttgtggaaagatgactcatct
acgaacgtgaaggaggtgaccaagacacagagaacaaggatgaggcgtgcccagacatcc
aattcacaagagatcagcaaagaggcatcaaaaacaagtggtagaaagaggcccagcaca
gcacgaagaaccacacaagttccagagaagaccaagaatgacgctgtggatttctctccc
acactccctgtgacctgtggtaaggccaaagggactttgttccaagagaaactgaagcaa
ggagcctcaaaaaagtgcattcagaatgaggcaggagattggctcactgtaaaggaattt
ttaaatgaagggggaagggccacatcaaaagactggaagggcgttatacgttgtaacggg
gagacattaagacatctggagcagaaaggacttttgttctttacctccaagagtaaacct
caaaagaagggtgcctag

DBGET integrated database retrieval system