KEGG   Mus musculus (mouse): 109077Help
Entry
109077            CDS       T01002                                 

Gene name
Ints5, 1110055N21Rik, mKIAA1698
Definition
(RefSeq) integrator complex subunit 5
  KO
K13142  integrator complex subunit 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    109077 (Ints5)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    109077 (Ints5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: INTS5_C INTS5_N
Motif
Other DBs
NCBI-GeneID: 109077
NCBI-ProteinID: NP_789813
MGI: 1923578
Ensembl: ENSMUSG00000071652
UniProt: Q8CHT3
Position
19; 19 A
AA seq 1018 aa AA seqDB search
MSALCDPPGAPGPPGPAPATHGPAPLSAQELSQEIKAFLTGVDPILGHQLSAREHARCGL
LLLRSLPPARAAVLDHLRGVFDESVRAHLAALEESPVAGPPHLRPPPPSHVPTGGPGLED
VVHEVQQVLCEFIRANPKAWAPVISAWSIDLMGQLSSTYSGQHQRVPHATGSLNELLQLW
MGCRATRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIIS
RVLSCGLKDFCVHSGAGGGASACGNSSQPPSTDPFPGSPAIPGEKRVPKIASVVGILGHL
ASRHGDSIRRELLRMFHDSLAGGSGGRNGEPSLQATVPFLLQLAVMSPALLGTVSGELVD
CLKPPAVLSQLQQHLQGFPREELDNMLNLAVHLVSQASGTGAYRLLQFLVDTAMPASVIT
TQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPRPVPFLDALRNHV
GELCGETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSPEELSLATQLYAG
LVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQQGGEGPSALGARFGE
SASAHLADLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVRAGVHHFFSSLRL
HGPPGVASASQLLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGEMDGDNETLSIVST
PLASASLLDINRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKIVQSRNHQEVIYNTQSLVS
LLVHCCSASGNSEREGCWGAPTLSPEAAKAVAVTLVESVCPDAAGAELAWPPEDHARATV
ERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALLSHWEASRHPDTTHSP
WHLEASCILVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGFLREHGPLPQKFI
FQSERGRFIRDFAREGGAEGGPHLSVLHSVLHRNIDRLGLFSGRFQAPPPSTLLRQGT
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgttgtgcgaccctcccggggccccagggccacccgggcctgcccccgccacc
cacggtcccgcgcctctcagtgctcaggagctgtcccaagaaatcaaggcttttttgacc
ggtgtagaccctattctgggccaccagctctcagctcgtgaacatgctcgatgtggtctt
ctcttgctccgttctttgccacctgctcgggctgctgtgttggaccacttgagaggtgtt
tttgatgagagtgtccgggcccacctagctgccctagaagaaagtcctgtggctggtcca
cctcacctccgtccacctccaccatcccatgtccctactggtggacctggcttagaggat
gtggtgcatgaagtgcagcaggtgctgtgtgagtttatccgggccaacccaaaggcctgg
gcacccgtgattagtgcatggtccattgacctcatgggacaactgagcagcacatattca
ggtcagcatcagcgtgttccccatgccactggctctctcaatgaactgctgcagctgtgg
atgggctgcagggccacccgcacattaatggacatctatgtgcagtgcctctcggccctc
attggtagctgcccagatgcatgtgtggatgccttgctagacacttctgtccagcattcc
ccacactttgactgggttgtggcccatattggctcttcttttcctggcaccatcatctcc
cgagtcctatcttgtggccttaaggacttctgtgtccatagtggggctggaggaggagct
agtgcttgtggaaactcttctcaacccccctctacagaccccttccctggatctcctgcc
atccctggggaaaaacgggtacccaagattgcctcagttgtaggcatcctagggcacctg
gcttcccgccatggagacagcatccgacgggaactgttgcgcatgtttcatgatagtttg
gcagggggttctgggggccggaatggagagccctctcttcaggccacagttcccttccta
ctgcagctggcagtcatgtcaccagctttgctcggcacagtatctggagaacttgtggac
tgcctcaagcccccagcagtgctaagccagctgcaacaacacctgcaggggttccccaga
gaagagctagacaacatgctaaacctggctgtgcatctagtgagccaggcctctgggact
ggtgcctaccgcctgctgcagttcttagtagacacagctatgcctgcttcagttattact
acccagggcctggctgtgccagacaccgtgagagaggcctgtgaccggctgatccagctg
ctattgctacatctacaaaaactagttcatcatcggggagggtctcctggagaaggggtg
ctgggcccacccccacctcctcgtccagtgccctttcttgatgcattacgaaaccatgtt
ggagaactgtgtggagagacattacggctagaacggaagcgcttcctctggcaacaccag
ctcctgggcctactgtctgtctatacacgacctagctgtggacctgaggccttgggtcat
ctactgagcagagccagaagccctgaagagttgagtttggcaacccagctatatgcaggg
ctagtggtcagtctctctggccttcttcccctggccttccgaagctgcctggctcgagtg
catgcagggactttacagcctcccttcacagcccggtttcttcgaaatttggccttgttg
gtggggtgggagcagcagggtggtgagggcccttcagccttaggggcccggtttggggag
tctgcctcagctcacctggctgatctggctcctctcctactacacccagaggaggaagta
gctgaagctgctgcctccctccttgcaatatgtccctttccttctgaagccctgtcccct
tcccaactattgggactagtgagagctggagtacaccacttcttctcttctctaaggctg
catggccctcctggtgtggcttcagcctctcagcttcttacccgcctttctcagacttcc
ccagctgggctcaaggctgtcctacagctgcttgtagagggagccttacatcggggcaac
acagaactatttggaggggaaatggatggagacaatgagaccctctcaattgtctcaacc
cctttggcttctgcctcattgttggacattaaccggaggcatactgcagcagtgccgggt
cctggagggatctggtcagttttccatgctggagttatcggccgtggcttaaagccacct
aaaattgttcaatctcgaaaccatcaagaagtgatctataacacccagagcctcgttagc
ctcctagtgcactgctgcagcgcatcagggaacagcgagcgtgagggttgctggggggct
cccaccctgagcccagaggcagccaaagcagttgcggtgaccttagtggagagcgtgtgt
cctgatgcagctggtgctgagctggcctggcccccagaggatcatgcacgagccaccgtg
gagcgggatctccgaattggtaggcgcttccgggaacaacctctgctgtttgagcttttg
aagctggtagcagctgctcccccagccctgtgctactgctccgtgctgctgcgggggctg
ctggctgccctcttgagccattgggaagcctctcgacaccctgatacaacccactccccc
tggcatctggaggcatcctgtatcctggtggctgtcatggctgagggaagcctcttgcca
ccagccctgggtaatatgcacgaggtatttagccaactggcaccttttgaagtgcgtctg
ttgctgcttagtgtctggggttttcttcgggagcatgggcccttgccccagaagttcatc
ttccagtctgaacgtggccgcttcatccgggactttgccagggagggtggagctgaagga
ggaccacatctgtctgtgctgcacagtgtcctccaccgcaacatcgatcgcctggggctc
ttctctggccgctttcaagcacctccgccatccactctgcttcggcaggggacttga

DBGET integrated database retrieval system