KEGG   Mus musculus (house mouse): 109129
Entry
109129            CDS       T01002                                 
Symbol
Mmadhc, 2010311D03Rik, AI314967, CblD
Name
(RefSeq) methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria
  KO
K26006  cobalamin trafficking protein CblD
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    109129 (Mmadhc)
SSDB
Motif
Pfam: MMADHC
Other DBs
NCBI-GeneID: 109129
NCBI-ProteinID: NP_598600
MGI: 1923786
Ensembl: ENSMUSG00000026766
UniProt: Q99LS1
Structure
Position
2:complement(50169893..50189033)
AA seq 296 aa
MAHVLCNRARLVSYLPGFCSLVKRVINPRAFSTAGSSGSDESHVATAPPDICSRTVWPDE
TMGPFGPQDQRFQLPGNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYV
NEFQDSDAPVEQEINSAETYFESAKVECAIQTCPELLRRDFESLFPEVANSKLMILTVTQ
KTENDMTVWSEEVEVEREVLLEKFISGAKEICYALRAEGYWADFIDPSSGVAFFGPYTNN
TLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIFTNATADSSIMRKLSGN
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcccatgtgctctgtaacagagccagactggtttcctatctcccaggattttgttct
ttagtgaaaagagtcatcaatccaagagccttttcaactgcaggatcttcaggttctgat
gagtctcatgtggccaccgcacctccagatatatgctctcgaacagtgtggcctgatgaa
actatgggaccctttggacctcaggaccagagattccagcttcctgggaatataggcttc
gattgtcacctcaatgggactgcctcacagaagaaaagccaggcccataaaactttgcct
gatgttctagcagagcctctttcaactgaaagacacgagtttgtgatggcgcagtatgta
aatgagtttcaggatagtgatgcacctgttgaacaagaaattaacagtgcagaaacttac
tttgaaagtgccaaagttgagtgtgcgatccagacatgtccagagctgctgcggagagat
tttgagtcactttttccagaagtggctaatagcaaactaatgatcctgactgtaacccag
aaaactgaaaatgacatgactgtctggagtgaagaggtggaggttgagagagaggtgctc
ttggagaagttcatcagtggtgctaaggagatctgctatgcccttcgggctgaaggatac
tgggctgacttcattgacccatcatctggtgtggcattttttggaccatataccaacaac
acactttttgaaacagatgaacggtaccggcatttaggattctcagttgacgaccttggc
tgctgtaaagtgatccgtcacagtctctggggcactcatgtggttgtaggaagtatcttc
actaacgcaacagcagacagcagtatcatgaggaagctcagtggaaactag

DBGET integrated database retrieval system