KEGG   Mus musculus (house mouse): 109136
Entry
109136            CDS       T01002                                 
Symbol
Mmaa, 2810018E08Rik
Name
(RefSeq) methylmalonic aciduria (cobalamin deficiency) type A
  KO
K07588  GTPase [EC:3.6.5.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109136 (Mmaa)
SSDB
Motif
Pfam: MeaB cobW AAA_22 ATP_bind_1 ABC_tran AAA_30 AAA_16 AAA_23 Thymidylate_kin NTPase_1 AAA_29 AAA_18 AAA DUF5906
Other DBs
NCBI-GeneID: 109136
NCBI-ProteinID: NP_598584
MGI: 1923805
Ensembl: ENSMUSG00000037022
UniProt: Q8C7H1
Position
8:complement(79990226..80021637)
AA seq 415 aa
MTISTLLLSPNRRLLTCLSRVPSPWLLHSSHPAPGPPGALPNCFGHHCTKRVLLSDGFRR
TLCVQATLKDHTEGLSDKEQRFVDRLYTGLVKGQRACLAEAITLVESTHTRKRELAQVLL
QRVLALQREQELRNQGKPLTFRVGLSGPPGAGKSTFIECFGKMLTEQGHRLSVLAVDPSS
CTSGGSLLGDKTRMIELSRDMNAYIRPSPTSGTLGGVTRTTNEAIVLCEGGGYDIILIET
VGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVVITKSDGDLIVPARRIQ
AEYVSALKLLRRRSEVWRPKVIRISARSGEGITEMWDTMREFQHQMLASGELAAKRQTQH
KVWMWNLIQENVLEHFKTHPSIREQIPLMERKVLSGALSPGRAADLLLKAFKSRH
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgactatttccacgctgctactttctcctaatcggcgtttactaacctgcctctcaaga
gtgccttccccatggctccttcactcaagtcaccctgcaccgggacccccaggtgctctg
ccaaactgttttggacaccattgtactaagagggtgctactgtctgacggcttcaggaga
acattatgtgtccaggcaaccttgaaggaccacacagaaggactttctgataaagaacaa
agatttgtggatagactttatacgggtttagtgaaaggacagagagcttgcctagcggag
gccataactctcgtggaatcaacccatacaaggaagagggagctggctcaggtgcttctg
cagagagtcttagccctccagcgggagcaggagctgcggaaccaaggaaagcccctcaca
tttcgagtaggactgtccgggccccctggtgcaggaaaatcaacattcatagaatgtttt
gggaaaatgctgactgagcaagggcacaggttatctgtgctagctgtggatccatcttct
tgcaccagtggtgggtccctcttaggtgataaaacccggatgattgagctgtcaagagat
atgaatgcctacatcaggccctctcctaccagtgggactctaggaggagtgacaaggacc
acaaatgaagccattgtgttgtgtgaaggagggggctatgacatcattcttattgaaacc
gtcggtgtagggcagtcggagtttgctgtggctgacatggtcgatatgtttgttttattg
ctgccaccagcaggaggggatgaactgcagggcatcaaaaggggcatcattgaaatggca
gatttggttgttataactaaatctgatggagacttgattgtgccagcccgcaggatccaa
gcagagtacgtgagcgcactcaagttgctccgtaggcgctcggaagtctggaggccaaag
gtgattcgcatttctgccagaagtggagagggcatcactgagatgtgggacacaatgaga
gagtttcagcaccaaatgctggccagtggggagctggctgccaagagacagacacagcac
aaagtctggatgtggaatctcattcaggaaaacgtcctagaacacttcaagacccacccc
agcatccgagaacagatccccctgatggagagaaaggtcctcagtggagccctctcccca
ggacgagcagcagacttgttgctaaaagcttttaaaagcagacactaa

DBGET integrated database retrieval system