KEGG   Mus musculus (mouse): 109136
Entry
109136            CDS       T01002                                 

Symbol
Mmaa, 2810018E08Rik, AI840684
Name
(RefSeq) methylmalonic aciduria (cobalamin deficiency) type A
  KO
K07588  GTPase [EC:3.6.5.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109136 (Mmaa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     109136 (Mmaa)
SSDB
Motif
Pfam: MeaB cobW AAA_22 ATP_bind_1 AAA_30 ABC_tran Thymidylate_kin AAA_16 AAA_23 NTPase_1 AAA_29 AAA_33
Other DBs
NCBI-GeneID: 109136
NCBI-ProteinID: NP_598584
MGI: 1923805
Ensembl: ENSMUSG00000037022
Vega: OTTMUSG00000061306
UniProt: Q8C7H1
Position
8; 8 C1
AA seq 415 aa
MTISTLLLSPNRRLLTCLSRVPSPWLLHSSHPAPGPPGALPNCFGHHCTKRVLLSDGFRR
TLCVQATLKDHTEGLSDKEQRFVDRLYTGLVKGQRACLAEAITLVESTHTRKRELAQVLL
QRVLALQREQELRNQGKPLTFRVGLSGPPGAGKSTFIECFGKMLTEQGHRLSVLAVDPSS
CTSGGSLLGDKTRMIELSRDMNAYIRPSPTSGTLGGVTRTTNEAIVLCEGGGYDIILIET
VGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVVITKSDGDLIVPARRIQ
AEYVSALKLLRRRSEVWRPKVIRISARSGEGITEMWDTMREFQHQMLASGELAAKRQTQH
KVWMWNLIQENVLEHFKTHPSIREQIPLMERKVLSGALSPGRAADLLLKAFKSRH
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgactatttccacgctgctactttctcctaatcggcgtttactaacctgcctctcaaga
gtgccttccccatggctccttcactcaagtcaccctgcaccgggacccccaggtgctctg
ccaaactgttttggacaccattgtactaagagggtgctactgtctgacggcttcaggaga
acattatgtgtccaggcaaccttgaaggaccacacagaaggactttctgataaagaacaa
agatttgtggatagactttatacgggtttagtgaaaggacagagagcttgcctagcggag
gccataactctcgtggaatcaacccatacaaggaagagggagctggctcaggtgcttctg
cagagagtcttagccctccagcgggagcaggagctgcggaaccaaggaaagcccctcaca
tttcgagtaggactgtccgggccccctggtgcaggaaaatcaacattcatagaatgtttt
gggaaaatgctgactgagcaagggcacaggttatctgtgctagctgtggatccatcttct
tgcaccagtggtgggtccctcttaggtgataaaacccggatgattgagctgtcaagagat
atgaatgcctacatcaggccctctcctaccagtgggactctaggaggagtgacaaggacc
acaaatgaagccattgtgttgtgtgaaggagggggctatgacatcattcttattgaaacc
gtcggtgtagggcagtcggagtttgctgtggctgacatggtcgatatgtttgttttattg
ctgccaccagcaggaggggatgaactgcagggcatcaaaaggggcatcattgaaatggca
gatttggttgttataactaaatctgatggagacttgattgtgccagcccgcaggatccaa
gcagagtacgtgagcgcactcaagttgctccgtaggcgctcggaagtctggaggccaaag
gtgattcgcatttctgccagaagtggagagggcatcactgagatgtgggacacaatgaga
gagtttcagcaccaaatgctggccagtggggagctggctgccaagagacagacacagcac
aaagtctggatgtggaatctcattcaggaaaacgtcctagaacacttcaagacccacccc
agcatccgagaacagatccccctgatggagagaaaggtcctcagtggagccctctcccca
ggacgagcagcagacttgttgctaaaagcttttaaaagcagacactaa

DBGET integrated database retrieval system