KEGG   Mus musculus (mouse): 109145Help
Entry
109145            CDS       T01002                                 

Gene name
Gins4, 2810037C03Rik, 4933405K01Rik, Sld5
Definition
(RefSeq) GINS complex subunit 4 (Sld5 homolog)
  KO
K10735  GINS complex subunit 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    109145 (Gins4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    109145 (Gins4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLD5_C Sld5
Motif
Other DBs
NCBI-GeneID: 109145
NCBI-ProteinID: NP_077202
MGI: 1923847
Ensembl: ENSMUSG00000031546
Vega: OTTMUSG00000060900
UniProt: Q99LZ3
Position
8; 8 A2
AA seq 223 aa AA seqDB search
MTEVLDLHGQDSDGGSEEMVLTPAELIEKLEQAWMNEKFAPELLESKAEIVECVMEQLEH
MEENLRRAKKGDLKVSIHRMEMERIRYVLSSYLRCRLMKIEKFFPHILEKEKVRSEGEPS
SLSPEEFVFAKEYMDHTETHFKNVALKHMPPNLQKVDLLRAVPKPDLDSYVFLRVKERQE
NILVEPEADEQRDYVIDLEVGSQHLIRYKTIAPLVASGAVQLI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggttctggatctccacggacaggactctgatgggggtagtgaggagatggtc
ctaactcctgcagagctcattgaaaagctggagcaggcctggatgaatgaaaagtttgcc
cctgagctcctggaaagcaaggctgagattgtcgaatgcgtcatggaacagcttgagcac
atggaagaaaatctcagaagagccaagaagggggatctgaaggtcagcatccatcgcatg
gagatggagaggatccgctatgtcctcagcagctatttgcggtgtcgactcatgaagata
gagaagtttttccctcacatcctagaaaaggagaaagtgcgcagtgagggggagccttcc
agcctgtctccagaggagtttgtctttgccaaagagtatatggaccacacggagacccac
tttaaaaacgttgccttaaagcacatgcctcccaacctgcagaaggtggacctcttgagg
gcagttcccaaaccagacctagattcatacgtgtttctgcgagtgaaagaacgacaagaa
aacatactagtagaaccagaagccgatgagcagagagactacgtgattgacttggaggtg
ggctcacagcacttgatccgatacaaaaccatcgcacctcttgttgcttctggagcagtt
cagctaatataa

DBGET integrated database retrieval system