KEGG   Mus musculus (mouse): 109181Help
Entry
109181            CDS       T01002                                 

Gene name
Trip11, 2610511G22Rik, 3110031G15Rik, 6030460N08Rik, AI450776, GMAP-210, TRIP230
Definition
(RefSeq) thyroid hormone receptor interactor 11
  KO
K23368  thyroid receptor-interacting protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    109181 (Trip11)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    109181 (Trip11)
  Retrieval pathways
    109181 (Trip11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4407
Motif
Other DBs
NCBI-GeneID: 109181
NCBI-ProteinID: NP_082722
MGI: 1924393
Ensembl: ENSMUSG00000021188
Vega: OTTMUSG00000039943
UniProt: E9Q512
Position
12; 12 E
AA seq 1976 aa AA seqDB search
MSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLLEGTEDVPADFPNSGREENEAT
HSVLRSENERLKKLYTDLEEKHEASELQIKQQSSSYRSQLQQKEEEINHLKARQLALQDE
LLRLQSAAQSAHLGSGSAPAASASSSFSYGVSHRVSAFHEDDMDFGDVISSQQEINRLSN
EVSRLESELGHWRHIAQTKVQGAQSSDQTEICKLQNIIKELKQNRSQDLDDHQHELSALQ
NAHQQKLTEISRRHREELSDYEERIEELENLLQQGGSGVTVTDHSKVYEMQNTIQILQME
KVESTKQIEDLENKIKEIHKRLSSAEHDQEVWKKEQERLEVEKREMTEQCERLKLELSEA
QQSALRQSDAAVEEETILPHSSSVAEVLRLQQALTDAENEIMRLRSLNQDISLAEDNQKL
QMCVQTLEKEKSLLSQEKEELQISLSKLSSEYEVIKSTATRDLDLFSQVHDLKHNLEAKE
QELNQSIHENEILMAELEELDKQNQEATKHVILIKDQLSKQQSEGDSVIKKLKEELAGEK
QRTHQLEDDKMNIIKELTVQKEKLTHSEQALSDLQLTKQKLEDKVEDLVDQLSKSEKNNF
DIQKENHELREHIRQNEEELSTVRSELTQSQTQGSSRNVKDDLLKERETQVQNLKQNLSE
VEQLNEHLEQVAFDLRTENEELLEAYEEVRNQLEESVAGNKQISLEKTAMLEWEKAPLET
ELCRAEKRVLEEERKYEQTVQELSSACSPDTSALQLEQERLIQLNQEKDFEIAELKKSIE
QMDTDHKRTKETLSSSLEEQKQLTQLINEKEICIVKLKEKSSELQKELDKCAQTLRKNET
LRQTIEEKDRSLGSMKEENNHLQEELERLREQQSRVVPAPEPRTLDSTTELESELSQLHR
IKGHLEEEIKHHQKMIEDQNQSKLQLLQSLQEQKKELDEFKYQHEQMSISHTRLFLEKDE
EIKNLQKTIEQIKAQLHEERQDSQTENSDIFQETKVQSLSIEHGSEKHDLSKAETERLVK
GIKERELEIKLLNEKNTSLTKQIDQLSKDEVGKLTQIIQQKDLEIQALHARISSASYSQD
VVYLQQQLHAYAMEREKVMVILNEKTRENSQLKTEYHKVIDIISAKEAALIKLQDENKKM
STRFESSGQDMFKETIQNLSRIIREKDIEIDALSQKCQTLLTVLQTSGTGSEAGGVNSNQ
FEELLQERDKLKQQVKKMEEWKQQVMTTVQNMQHESAQLQEELHQLQAQVSVDSDNNSKL
QVDYTGLIQSYEQNETKLKNFGQELAQVQHSIGQLCNTKDLLLGKLDIMSPQLSSGSSLT
SQAAEPLRASQSSEPHESSQLLQQEVDDLRKSLQEKDATIRTLQENNHRLSDSVAASSEV
ERKEHEQADSEIKQLKEKQEVLQNLLKEKDLLIKAKSDQLHSSNENLANKVNENELLRQA
VTNLKERILILEMDISKLKGENEKIVDASKGKETEYQALQETNMKFSMMLREKEFECHSM
REKALAFEQLLKEKEQGKAGELNQLLNAVKSMQEKTVTFQQERDQVMLALKQKQMETSTL
QNEVQRLRDKESRLNQELQRLRDHLLESEDSHTREALAAEDREAKLRKKVSVLEEKLVSS
SNAMENASHQASVQVESLQEQLNMVSKQRDETALQLSVSQEQVKQYALSLANLQMVLEHF
QQEEKAMYSAELEKQNHLLAEWKKKAESLEGKVLSLQERLDEANAALDSASRLTEQLDLK
EEQIEELKKQNELHQEMLDDAQKKLMSLVNSTEGKVDKVLMRNLFIGHFHTPKHQRHEVL
RLMGSILGVKREEMEQLFAEDQGGVTRWMAGWLGGGSKSVPNTPLRPNQQSVFNSSFSEL
FVKFLETESHPSVPPPKLSVHGLKPLDSPGRRKADTGIPESFRDTAESRAGRRTDVNPFL
APRSAAVPLINPAGHGPGGPGHLLLKPISDVLPTFTPLPVSPDNSAGVVLKDLLKQ
NT seq 5931 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggctcgggggcctcggctccggcttgggccagtctctcggtcaagtaggg
ggcagcctggcttccctcactggccagatttcgaacttcacgaaggatatgctgttggag
ggcacggaggatgtgccagcagatttccctaattccgggagagaggagaatgaagccact
cattcagtcttaagatcagagaatgaaaggcttaaaaagctttacactgatctagaggaa
aagcatgaagcatccgaacttcaaattaagcagcaatcttccagttaccgaagtcagtta
cagcagaaagaggaagaaatcaaccaccttaaagcaaggcagctcgcactacaggatgaa
ctgctcagactgcagtcagctgctcagtcagcccacttaggatctggcagcgcaccagca
gccagtgcatcatcttcattcagctatggggtcagtcatcgtgtgtcagccttccatgaa
gacgacatggactttggtgatgtgatctcatcacaacaagaaataaacagattatcaaat
gaagtttcaagacttgagtctgaacttggacattggagacatattgctcagactaaggta
cagggagcacaaagctctgatcaaactgaaatctgcaaactacaaaatattattaaggaa
cttaaacagaacagaagtcaggacctcgatgaccatcagcatgagctgtcagccctgcag
aacgctcatcagcagaagctgacagagataagtcggcggcatcgagaggagttaagtgac
tatgaagagcgtattgaagaactggaaaatctgttacagcaaggtggctcaggagttacg
gtaactgatcactctaaagtgtatgagatgcaaaacactattcagatcttacagatggaa
aaagtagaatctaccaaacaaatcgaagaccttgagaataaaataaaagagatacataaa
agattgtcttctgcagaacatgaccaggaagtctggaaaaaagaacaagagcggctggaa
gtggaaaagagagagatgactgagcagtgtgagcgcttgaagctggaactcagtgaagcc
cagcagagtgctctgcggcagagtgatgctgcggtggaggaggagacgatcctcccacac
agctcctcagtcgcagaggtcctgagattgcagcaagctttgactgatgctgaaaatgaa
ataatgagactaaggagtttaaaccaggatatcagtcttgctgaagacaatcagaaactt
caaatgtgtgtccaaactttagaaaaagagaagtctttattgagtcaagaaaaggaagaa
cttcagatatcactttccaaactgagcagtgaatatgaagtcattaaaagtacagctaca
agggacttagatttgttttctcaagtacatgacttaaaacataacctggaggcgaaggag
caagaactgaaccagagtattcatgaaaatgaaatccttatggctgaattagaagaactg
gacaagcagaaccaagaggctactaagcatgtgattttgataaaagatcagctatcaaaa
caacaaagtgaaggagatagtgtcatcaagaaactgaaagaagagctagctggtgagaag
cagagaacccatcagcttgaggatgataaaatgaatattattaaagagttaaccgtacag
aaagaaaagctaactcacagtgaacaggccctaagtgatttacagttaaccaaacagaag
cttgaagataaagtagaagatttagtagatcagctaagtaaatcagagaaaaacaatttt
gacattcagaaggagaaccatgaactgagggaacacatcagacaaaatgaagaggagctg
tccacagtcaggagtgagttaactcagtcccaaacccagggctccagcaggaacgtgaag
gatgacttacttaaagaaagggaaactcaagttcaaaacttaaagcaaaatctttcagaa
gtagaacagctcaatgaacatttagagcaagttgcttttgatctcagaacagaaaatgaa
gagttgcttgaagcatatgaagaggtaagaaatcagttggaagaatctgttgctggcaac
aagcagatttctctggaaaaaactgctatgctggaatgggaaaaggcaccactagaaaca
gagctgtgtcgagctgaaaagcgggtgttggaagaagagcggaagtacgagcaaactgtc
caggaactgtccagcgcgtgcagccccgatacctccgccttacagctggaacaggagcgc
ttaattcaactcaatcaagaaaaagactttgaaatagcagaactcaaaaaaagtattgag
caaatggatactgatcataaacgaaccaaggagactttgtcatctagtttagaagagcag
aaacaattgacacaacttataaatgagaaagagatttgtattgtgaaacttaaagaaaaa
agttcagaactgcagaaggaattagacaaatgtgctcagaccttaaggaaaaatgagact
ttaaggcagaccatagaagaaaaggatagaagtcttggatccatgaaagaagagaacaat
cacttgcaagaggagctggagcggctccgggagcagcagagtcgggtagtgcccgcgcct
gagcccagaacccttgacagcaccaccgagctggagtctgagctgtctcagctgcacaga
atcaagggtcatctggaagaagagattaaacatcaccagaagatgattgaagatcaaaac
cagagcaagctgcagctactccagtctctacaggagcagaagaaagaactggatgagttt
aaataccagcatgaacaaatgagtatctcacacacacgactctttttagaaaaagatgag
gaaattaagaacttgcaaaaaacaattgaacaaataaaagcccagttgcatgaagaaagg
caggatagtcaaacagagaattccgatatttttcaagaaacaaaagttcagagccttagt
atagaacatggaagtgaaaaacatgacctctctaaagcggagacggaaaggttagtgaag
gggataaaggagagggagctggagatcaagcttctgaatgagaagaacacctcgctaact
aaacagatcgatcagctgtccaaagacgaggtcggcaagctcacgcagatcatccagcag
aaggacttggagatacaggctcttcatgccaggatctcctccgcgtcctactcacaggat
gttgtgtaccttcagcagcagctgcatgcatacgctatggaaagagagaaagtgatggtt
attttgaatgagaagacaagggaaaatagccagctaaaaacagaatatcataaggtgatc
gatattattagtgccaaagaagcagcccttattaagttgcaagatgagaataagaaaatg
tccactagatttgaaagtagtggtcaagatatgtttaaagaaactattcagaatttatcc
cggatcattcgagaaaaggacattgagatcgatgcactgagtcagaagtgccagaccctg
ctgacagtcttgcagacttctggcacggggagtgaggctggaggggttaacagtaaccag
tttgaggagctcttacaggagcgggataaactgaagcagcaggtgaagaaaatggaggag
tggaaacaacaagtgatgaccaccgtccagaacatgcagcacgagtctgcccagctccag
gaagagcttcaccaacttcaggcacaagtttcggttgacagtgataacaattctaaactg
caagtggactacacaggcctgatccaaagttatgagcagaatgaaaccaaacttaagaac
tttgggcaggaattggcacaagttcagcatagcatagggcagctttgtaataccaaggac
cttcttttaggaaaacttgatattatgtctcctcagctctcctctggctcatcacttacc
tctcaggcagcagagcctcttagagcaagccagtcttctgagccacatgagtcttctcag
ttgcttcaacaagaagtagatgatctgagaaaatcactgcaggagaaagatgccacaatt
cgaacgctccaggaaaacaatcatagactgtctgactctgttgctgcttcctcagaggta
gaaagaaaagaacacgagcaagctgattcagaaattaagcagctgaaggaaaaacaagag
gttttacaaaacttgcttaaggaaaaagacctcttaatcaaagccaaaagtgaccaatta
cattcttcaaatgaaaaccttgctaacaaagtgaatgaaaacgagcttttgaggcaggca
gtgacaaatttgaaggagagaatattgattttagaaatggacatttctaaattaaaaggg
gaaaatgaaaaaatagtagacgcatccaaggggaaggaaacagaataccaggcgttacaa
gagaccaacatgaagttttccatgatgttacgagaaaaggagtttgaatgccattcaatg
agagagaaggcacttgcttttgagcaactactgaaagaaaaagaacagggcaaggctggg
gagctaaatcaacttttaaatgcagttaaatcaatgcaggagaagacagttacgtttcag
caggaaagagaccaagttatgttggccctgaaacagaagcaaatggaaaccagtaccctg
cagaatgaggtccagcgcttacgggacaaagaatcccggctgaaccaggagctacagaga
ctgcgtgaccacctcttagagtcagaagactctcatacgcgggaagctttggctgcagaa
gacagagaggccaaactgaggaagaaggtctcggtgttggaggaaaagctggtgtcatcc
tctaatgcaatggaaaacgcaagtcatcaagccagtgtgcaagtagagtctttacaagaa
caactgaacatggtctccaagcaaagagatgagactgccctgcaactctctgtctctcag
gaacaagtgaagcagtatgctttgtcactagccaatctgcagatggttcttgaacacttc
caacaagaggaaaaagctatgtattctgctgaattagaaaagcaaaaccacctcttagct
gaatggaagaaaaaggcagagagtctggaaggaaaagtgttatcgctgcaggaacgtttg
gatgaagcaaatgctgcactggattcagcatcaagacttacagaacagttagatttaaaa
gaagagcaaattgaagaacttaaaaagcaaaatgagctccaccaagagatgctggacgac
gcgcagaagaaactgatgagcttggtcaacagcacagaagggaaagtggacaaagtcctc
atgagaaacctctttatcggtcatttccacacacctaaacaccagcgtcacgaagtcctt
cggctcatggggagcatcctgggtgttaaaagggaagagatggagcagctgtttgcagaa
gatcaaggaggtgttactcggtggatggctggatggctgggaggaggatcgaaaagtgtg
cccaatacacctttgagaccaaatcagcagtctgtgttcaatagttctttttcagaactc
tttgttaaatttctggaaacagaatctcatccatctgtcccgcctccaaagctgtcagtc
catggcctgaagcctctagattctccaggaagaaggaaagctgacacaggcatacccgaa
agttttagagatacagcagaatccagggcaggaagaagaacagatgtgaatccattcttg
gctccccgctcagcagctgtgccccttattaacccagctggacatggacctggtgggcct
gggcatcttcttttgaaacccatctcagatgttctacccacgtttacacctttgccagtg
tcacctgacaacagtgcaggtgttgtattgaaagaccttctaaagcaatag

DBGET integrated database retrieval system