KEGG   Mus musculus (house mouse): 109232
Entry
109232            CDS       T01002                                 
Symbol
Sccpdh, AW214504, C330023F11Rik
Name
(RefSeq) saccharopine dehydrogenase (putative)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Sacchrp_dh_NADP Sacchrp_dh_C LVIVD
Other DBs
NCBI-GeneID: 109232
NCBI-ProteinID: NP_848768
MGI: 1924486
Ensembl: ENSMUSG00000038936
UniProt: Q8R127
Position
1:179495171..179514754
AA seq 429 aa
MATEQRPFHLVVFGASGFTGQFVTEEVAREQIASEQSSRLPWAVAGRSKEKLQQVLEKAA
QKLGRPSLSSEVGVIICDISNPASLDEMAKQAKLVLNCVGPYRFYGEPVVKACIENGTSC
IDICGEPQFLELMHAKYHEKAAEKGVYIIGSSGFDSIPADLGVLYTRNQMNGTLTAVESF
LTINTGPEGLCIHDGTWKSAIYGFGDKGSLRKLRSVSCLKPVPIVGTKLKRRWPVSYCRE
LNSYSIPFLGSDISVVKRTQRYLHENLEDSPVQYAAYVTVGGITSVIKLMFAGLFFLFFV
KFSIGRQLLIKFPWLFSFGYFSKQGPTQKQMDETSFTMTFFGQGYSHGTCVEKNKPNIRI
CTQVKGPEAGYVATPIAMVQAAMTFLSDASDLPKGGGVFTPGAAFSRTKLIDRLNKHGIE
FSVISSSEV
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcgacggagcagaggcctttccacctggtggtgttcggcgcctctggcttcaccggc
cagttcgtgacggaggaggtggcccgggagcagatagcctcggagcagagctcccgcctg
ccctgggccgtggcgggtcgctccaaggagaagctgcagcaagtgctggagaaggctgcc
cagaaactgggaagaccatcactatcatctgaagttggagtcataatctgtgatatcagt
aatccagcctcacttgatgaaatggctaaacaggcaaagcttgtcctcaactgcgtagga
ccgtatcgattttatggagaacctgtagtaaaagcatgtattgaaaatggaacaagttgt
attgacatctgtggggaacctcagtttctggaactaatgcatgcgaagtatcatgagaaa
gctgcagagaagggggtttatatcattggaagcagtggctttgactccatcccagcagat
ctaggagtgctatacaccaggaaccagatgaacggtactttgactgctgtagaaagcttc
ctgacaataaatacaggacctgaggggttgtgtattcatgatggaacctggaagtcggca
atttatggttttggcgataagggtagtttaagaaaactacggagtgtatcatgtctgaaa
cctgtcccaattgttggtacaaagttgaaaagaaggtggccagtcagctattgtagagag
ctgaactcgtattccattccttttttgggatctgatatatctgttgtgaaaaggactcag
cgttacttacatgaaaatttagaggactcaccagttcagtatgctgcttatgtgacggtg
ggaggcatcacctctgtgattaagctgatgtttgcaggactgttctttttattctttgtg
aagtttagcattggaagacaacttctcataaaattcccatggctcttttcctttggctat
ttttcaaaacaaggtccaacacaaaaacagatggatgagacatcatttacaatgacattc
tttggtcaaggatacagccatggcacttgtgttgaaaagaacaaaccaaatatccgaatc
tgcactcaagtgaagggaccagaggctggctacgtggctactcccatagccatggttcag
gctgccatgacttttctgagtgacgcctctgaccttccaaaagggggcggtgtctttaca
cctggagcagctttctccagaacaaagttgattgacagactcaacaaacatggcattgaa
tttagtgtcattagcagctccgaagtctaa

DBGET integrated database retrieval system