KEGG   Mus musculus (mouse): 109272Help
Entry
109272            CDS       T01002                                 

Gene name
Mybpc1, 8030451F13Rik
Definition
(RefSeq) myosin binding protein C, slow-type
  KO
K12557  myosin-binding protein C, slow-type
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    109272 (Mybpc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109272 (Mybpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 THB V-set C2-set_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 109272
NCBI-ProteinID: NP_001239301
MGI: 1336213
Ensembl: ENSMUSG00000020061
Vega: OTTMUSG00000031731
UniProt: D3YU50 Q6P6L5
Position
10; 10 C1
AA seq 1127 aa AA seqDB search
MPEPTKKEENEVSAPAPPPEEWSLGESPAGGEEQDKQNANSQLSTLFVEKPQTGSVKVGA
NITFVAKVRAEDLLRKPTVKWFKGKWMDLASKAGKHLQLKETFERQTRVYTFEMQIIKAK
ENYAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGL
LKRREVKQQEEEPEIDVWELLKNANPNEYEKIAFQYGITDLRGMLKRLKRMRRVEKKSAA
FAKILDPAYQVDKGGKVRFVVELADPKLEVKWFKNGQEIRPSTKYIFEHKGNERIMFINN
CSLTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDMNAYCGERVEMEVEVSEDDANVK
WFKNGEEIFPGPKSRYKIKVEGKKHTLIIEGATKADSAEYSAMTTGGQSSAKLSVDLRPL
KITTPLTDQTVKLGKEVCLKCEISENVPGKWTKNGLPVQEGERLKVVHKGRIHKLVIANA
LIEDEGEYVFTPDAYNVPLSAKVHVIDPPKIILDGLDADNTVTVIAGSKLRLEIPVTGEP
PPKAIWSRADKAIMEGSGRIRAESYPDSSTLVIDVAERDDSGVYNINLKNEAGEAHASIK
IKVVDIPDPPVAPNVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL
CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSKPFVPLAVTSPPTLLAVDSVTDSS
VTMKWRPPDQIGAAGLDGYVLEYCFEGTEDWIVANTDLIDKTKFTINGLPTDAKIFVRVK
AINAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL
TWKKDGEEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKYVENASIDIQIVDR
PGPPQTVTIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTNAT
ITELVIGNEYYFRVFAENMCGLSEDATMTKESAVIAKDGKIYKNPVYEDFNFTEAPMFTQ
PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP
YDGGTYCCKAVNDLGTVEIECKLEVKVIYQGVNTPGQPVSLEGQQQS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacccactaagaaagaggaaaatgaagtgtccgccccagcccctcccccggaa
gaatggtctcttggtgagtcacctgctggcggggaagagcaggacaaacagaatgccaac
tcccagctgtccaccctgtttgttgaaaaacctcaaaccggatcggtgaaagttggtgca
aacatcacctttgtagccaaagttagggctgaagatcttcttagaaaacccactgtcaaa
tggttcaaggggaaatggatggatctggccagcaaagccgggaaacacctgcagctgaag
gagaccttcgagaggcaaactcgggtatacacattcgagatgcagatcatcaaagccaaa
gagaactacgcagggaattataggtgtgaggtcacctacaaggataaatttgacagctgt
tcgtttgatcttgaagtccatgagtctactgggactactccaaacattgacatcagatct
gccttcaaaagaagtggagaaggtcaagaggatgcaggggaacttgactttagtggtctc
ctgaaacgtagggaggtgaagcagcaggaagaggagcctgagatagacgtgtgggagctg
ctgaaaaatgccaaccccaacgaatacgagaagatcgctttccagtatggcatcaccgac
ttgcgtggcatgcttaagcggctcaagcgcatgcgcagggtggaaaagaagagcgcagct
tttgcaaaaattctcgatcctgcatatcaggtggataaaggaggcaaagtgagatttgtc
gtggagttggcagacccaaaactggaggtgaaatggtttaaaaatggccaagagattcga
cccagcacaaaatacatctttgagcacaaaggaaacgagagaatcatgtttattaataac
tgttcgctgacagatgattcggagtactatgtgacagctggagatgagaaatgttctact
gagctctttgtaagagagcctccaatcatggtgactaagcagctggaagacatgaacgct
tactgtggggagagggtagagatggaagttgaggtgtctgaagatgacgccaatgtaaaa
tggtttaagaatggtgaagagatcttccctggtccaaagtcaagatacaagattaaagtt
gaaggcaaaaagcacacgttgatcatagaaggggcaacaaaggctgacagtgcggagtac
tcagccatgacaaccgggggacaatcatctgccaaactcagcgttgacttgagacctcta
aagatcacgacgcctctgacggaccagacagtaaaacttgggaaagaagtatgcttgaag
tgtgaaatctctgaaaatgtaccaggaaaatggacaaaaaatggcctccctgttcaggag
ggtgagcgtctgaaggttgttcacaagggaagaatccacaagttagtcatagccaatgct
ctcattgaagatgaaggtgaatatgtatttacaccagatgcctacaatgttcctttgtct
gccaaagttcatgtcatcgaccctcccaagatcatcctggatggcctggatgctgataac
acagtgacagtgatagctggaagcaagcttcgcctggagattcctgtcacaggggaacca
cctcccaaagccatctggagccgagcagataaggctattatggaaggcagtggtcggatc
agggcagaatcctaccctgacagcagcacactggtcattgacgtggcagagagagacgac
tctggtgtgtacaacataaatctgaaaaatgaggctggagaagcacatgcaagcatcaag
attaaggttgtggatatccctgatcctccagtggcaccaaatgtgacagaagtgggagat
gactggtgcatcatgaactgggagcctcctgcctatgatggagggtctccaatcttagga
tactttattgagaggaaaaagaaacaaagctccaggtggatgagactgaatttcgatctc
tgcaaagagacaacttttgagcccaagaagatgattgaaggcgtggcctacgaggtccga
atctttgcggtcaacgccattggcatctccaagcccagtatgccctccaagccctttgtt
cctttggctgtgaccagccctcctactcttctggctgtcgactccgtgactgactcgtct
gtgacgatgaagtggaggcccccagatcagattggcgcagcaggtttagatggctatgtg
ctagagtattgctttgaaggaactgaggactggatagttgcaaacacagacctgatcgac
aagaccaagttcaccatcaatggtctgcccacggatgcgaagatctttgtacgtgtgaag
gctattaacgcggctggggctagtgagcccaagtactattctcagcccatccttgtgaag
gaaatcattgagccaccaaagattcgcatcccaaggcatctgaagcaaacttacatccgc
agagtcggagaagctgtcaatctggtgattccttttcagggtaaaccaagaccagagttg
acctggaagaaggacggtgaagaaattgacaagaatcaaataaacattcgcaactcagaa
actgataccatcatattcatccggaaagcagagcggagccactcgggcaagtacgacctg
caggtcaaagtggataaatacgtggaaaatgcctctatcgacatccagattgttgaccgt
ccaggtccaccccagactgtgactattgaagatgtgtggggagagaatgttgccctaaca
tggacaccaccaaaggacgatgggaatgctgccatcacagggtacaccatccagaaggcc
gacaagaaaagcatggaatggttcaccgtcattgaacattaccaccgaaccaacgccacc
attactgagctggtcatagggaacgagtattacttccgggtctttgctgaaaacatgtgc
ggccttagcgaggatgcaactatgacgaaggagagtgcagtgattgccaaggacggtaag
atctataaaaatccagtgtacgaagacttcaatttcacagaggcccccatgtttactcaa
cctttggttaacacctatgccatcgctggttacaatgccaccctgaactgcagcgtccga
ggaaatcccaagcccaaaatcacctggatgaaaaacaaagtggctattgtggatgaccca
agatacagaatgttcagcaaccaaggagtctgtaccctggagatccgcaagcctagtcct
tatgacggaggcacgtactgctgcaaagcagtcaatgacctcgggacggtggagattgaa
tgcaaactggaggtgaaagtgatatatcaaggagtaaatacccctggacagccagtctcc
ctggaggggcagcaacagtcgtag

DBGET integrated database retrieval system