KEGG   Mus musculus (mouse): 109275Help
Entry
109275            CDS       T01002                                 

Gene name
Actr5, AA545173, B430109J19Rik
Definition
(RefSeq) ARP5 actin-related protein 5
  KO
K11672  actin-related protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    109275 (Actr5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    109275 (Actr5)
   INO80 complex (yeast)
    109275 (Actr5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin DUF1542
Motif
Other DBs
NCBI-GeneID: 109275
NCBI-ProteinID: NP_780628
MGI: 1924748
Ensembl: ENSMUSG00000037761
Vega: OTTMUSG00000015937
UniProt: A0A0A0MQ89
Position
2; 2 H1
AA seq 608 aa AA seqDB search
MEANVFRFRDARSAPDPVLEAGPVAFGSQPVPLVLDNGSFQARAGWACPGPDPGPEPRLQ
FRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPKVAYGIDSLFSFYHNVPKNAL
SSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILQEHSYIAEDYGAELQKWQCPDYYENNVHKMQLPFSSKLLGSTLTAEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLERLLYVQELLEEGQMDQFHKALIELNMDSPEELQSY
IQKLTLAVEQAKQKILQAEASLEVDVVDSKPETPDLEPLEPTMEDVENISDFEPLFSEET
PEVEKPQVTTVQPVFNLAAYHQLSVGTERIRAPEIIFQPSLIGEEQAGIAETLHFVLDRY
PKAIQDTLVQNVFLTGGNVMYPGMKARVEKELLEMRPFQSSFQVQLASNPVLDAWYGARD
WALDHLEDSGAWVTRKDYEEKGGEYLKEHCASNTYVPIRLPKQASRASETQTSGRGSSAS
GSGAGDQA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaacgtgttccgcttccgagatgcccgctctgctccggatcccgtgctcgaa
gccgggccggtggccttcgggtcgcagccggtgcctctggtgctggacaacgggtcgttc
caggctcgggccgggtgggcgtgccccgggccggaccccggtcccgagcctcgcctgcag
ttccgcgccgtgtgtgcgcgcggccgcggcggggcgcgcggcgggccggggccgcaggtg
ggcaacgcgctgggaagcctggagcctctgcgctggatgctgcgctcgcccttcgatcgc
aacgtcccggtcaacctggaactgcaggaactgctgctggactacagcttccagcacctc
ggcgtctcctcgcagggctgcgttgatcatcccatagttctgacagaggctgtgtgtaac
cccctctactcccgtcaaatgatgtcggagctccttttcgaatgctacaggatcccgaag
gttgcctatgggatagacagcctcttcagcttctaccacaacgtgcccaagaatgccctt
tccagcggcctcatcatttcatccggctaccagtgcacacacatcttaccggtcttggaa
gggaggctcgatgccaaaaactgcaagcgcatcaatcttggaggaagtcaggcagctggc
tacctgcagcggcttctccagctgaagtatccaggccacctggcagccatcacactcagc
cgcatggaggagatcctgcaggagcatagctacattgccgaggactacggggcagaattg
cagaagtggcagtgtcccgattactacgagaacaatgtccacaagatgcagctcccgttc
tccagcaagctcctgggcagcacactgacggcggaggagaagcaggagcggcggcagcag
cagctgcgccggctgcaagagctcaacgcccggcggagggaggagaagctgcagctggat
caggagcggctggagcggctgttgtatgtgcaggagctcctagaggaaggacagatggac
cagtttcacaaagctctgatcgagctgaacatggactccccagaagaactgcagtcctac
atacagaagctcaccttggcggtggagcaggccaaacagaaaatcctgcaggccgaagcc
agcctggaggtggatgtggtagacagcaagccagagacccctgacctggagccgctggaa
cccaccatggaggatgtggagaacatcagtgatttcgagcctttgttctcggaggaaacg
cccgaagtggagaagccgcaagtcaccacagtccagcccgtgtttaacttggcagcgtat
catcagctgtctgttgggacagagaggatccgtgctccggagattattttccagccatcc
ctcataggagaggagcaggcggggattgcagagaccctccattttgtcctggacaggtac
ccaaaggccattcaggacaccctggttcagaacgttttccttaccggtgggaacgtgatg
tacccaggcatgaaggcccgagtggagaaggagctgctggagatgaggcccttccagtcc
tccttccaggttcagctcgcctcgaaccctgtgctggatgcgtggtacggtgcccgtgac
tgggccttggatcacctagaagacagtggagcctgggtcaccaggaaggactatgaagaa
aaggggggcgagtacctcaaggaacattgcgcctccaacacgtacgtccccatccgcctg
cctaagcaggcctcacgtgcctcagagacgcagacttccggccgaggctccagcgccagt
ggaagtggggctggtgatcaggcctag

DBGET integrated database retrieval system