KEGG   Mus musculus (mouse): 109333
Entry
109333            CDS       T01002                                 

Gene name
Pkn2, 6030436C20Rik, AI507382, PR, PRK2, Prk, Prkcl2, Stk, Stk7
Definition
(RefSeq) protein kinase N2
  KO
K23691  serine/threonine-protein kinase N2 [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109333 (Pkn2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109333 (Pkn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109333 (Pkn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    109333 (Pkn2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109333 (Pkn2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKN family
   109333 (Pkn2)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like Uds1 C2
Other DBs
NCBI-GeneID: 109333
NCBI-ProteinID: NP_848769
MGI: 109211
Ensembl: ENSMUSG00000004591
Vega: OTTMUSG00000036912
UniProt: Q8BWW9
Position
3 H1; 3 66.69 cM
AA seq 983 aa
MASNPDRGEILLTELQGDSRTLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKNLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDSTDCPR
TPDTPNSDSRSSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFKIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNELPRNHPKSSVVIEELSLVA
SPTLSPRQSMLSTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSP
SDNRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKF
TLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNP
VIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQTPVP
ATVPVVDARIPDLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGETDESSELRVLDIPGQ
GSETVFNIENDRNNLRPKSKSEYELSIPDSGRSCWGVGELDDKRAQQRFQFSLQDFRCCA
VLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLV
NLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYR
DLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWW
GLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLG
AGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPR
EPRILLEEEQEMFHDFDYVADWC
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggcgtccaaccccgaccggggggagatcctcctcaccgagctgcagggagattcccgg
actcttccattttctgagaatgtgagtgctgttcagaaattagacttttcagatacaatg
gtgcaacagaaattggacgacatcaaggatcgaataaagagagaaataaggaaagaactg
aaaatcaaagaaggagctgaaaacctgaggaaagttacaacagataagaaaaatttggct
tatgtagacaacattttgaaaaaatcaaataaaaaattagaagaattacatcacaagcta
caagaattaaatgcacacatcgttgtatcggatccagaggactccacagattgtccgagg
actccagatactccaaatagtgactctcgtagttctactagcaacaatagactgatggcc
ttacagaaacaactggatatagaacttaaagtaaagcagggtgcagagaacatgatacag
atgtactcaaatggctcttcaaaggatcggaaactccatggtacagcgcagcaactgcta
caggatagcaagacaaaaatagaagtcatccggatgcagattcttcaggccgtccagacc
aatgagctggcttttgataatgcaaaacctgtgataagccctcttgagcttcggatggaa
gaattaagacatcattttaagatagaatttgcagtagccgaaggtgcaaagaatgtcatg
aagttacttggctcaggaaaagtaacagacagaaaagcgctttcagaagcacaagcgaga
tttaatgaatcaagtcagaagttggaccttttaaagtattcactagagcaaaggttaaat
gagctccccaggaatcaccccaaaagcagtgtcgtcattgaggagctttcactggttgcg
tcaccaaccctgagtccacggcagagcatgctgtccacgcagaaccagtatagcacactg
tccaagccagcggcgctaaccggtactttggaagttcgtcttatggggtgccaagatatc
ctagagaatgtacctggacggtcaaaagcaacgtcggtagcactacctgggtggagtcca
agtgacaacagatcgtcttttatgagcagaaccagcaagagtaaaagtgggagtagtcgc
aacctcctgaaaacggatgacttgtccaatgatgtttgtgctgttttgaagctagataat
actgtggttggtcaaactagctggaaacccatttcaaatcagtcgtgggaccagaagttt
acactggaactagacaggtcacgtgaactggaaatttcagtttattggcgtgattggcga
tctctgtgtgctgtaaaatttctgaggttagaagattttttagacaaccagcggcatggc
atgtgtctctatttggaaccacagggtactttgtttgcagaggttactttttttaatcca
gttattgaaagacgaccaaaactccaaagacaaaagaaaattttttcaaaacaacaaggc
aaaacatttctcagagctcctcagatgaatattaatattgccacttggggaagactagtg
agacgagctattcccacagtaaatcattctggcacattcagccctcagactcctgtgcct
gcaacagtgccagtcgttgacgcacgcattcctgatctagcacctccggccagtgactct
acagtaaccaaattggactttgatcttgaacctgaacctcctccagccccacctcgtgct
tcttcccttggagagacagatgaatcttctgaattgagagttttggatatacctggacag
ggttcagaaactgttttcaatattgagaatgacagaaataacctgcgtccaaaatccaaa
tctgaatatgagctgagcattcctgactcaggtcgaagctgctggggtgttggagagctt
gatgacaagagagctcagcagaggtttcagttcagtctacaggacttcaggtgctgtgct
gtcttggggagaggacactttggaaaggtgctgttggcggaatataaacacacaaatgaa
atgtttgcaataaaagccttaaagaaaggagacattgtggcacgagatgaagtagacagc
ctgatgtgtgaaaaaagaatttttgagactgtgaatagtgtcaggcacccgtttctagtg
aacctttttgcatgtttccaaacaaaagaacatgtttgcttcgtgatggagtatgctgca
ggtggtgacctgatgatgcacatccatactgatgtcttctctgaacccagagctgtattt
tatgcagcatgtgtagttcttgggttgcaatacttacatgaacacaaaattgtttataga
gatttgaagttggataacttgttgctagatacagaaggctttgtgaaaattgctgacttt
ggtctttgcaaagaaggaatggggtatggagataggacaagcacattttgtggtactcct
gagtttcttgccccagaagtcctaacagaaacatcgtacacaagggctgtagattggtgg
ggccttggtgtacttatatatgagatgctcgtcggcgagtctccctttcctggtgatgat
gaagaagaggtttttgacagtattgtaaatgacgaagtaaggtatccaaggttcttatct
acagaagccatttccataatgagaaggctgctaaggagaaatcctgagcggcgcctggga
gctggtgagaaggatgcagaggatgtcaagaagcacccgtttttccggctaaccgactgg
agtgctctaatggacaaaaaagtaaagccaccatttgtacctaccattagaggacgggaa
gatgttagtaactttgatgatgaatttacctcagaagcacctattctgactccacctcga
gaaccaaggatactcttggaagaggagcaggagatgttccacgattttgactacgttgct
gattggtgttaa

KEGG   Mus musculus (mouse): 263803
Entry
263803            CDS       T01002                                 

Gene name
Pkn3, AW209115, BC034126
Definition
(RefSeq) protein kinase N3
  KO
K23692  serine/threonine-protein kinase N3 [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    263803 (Pkn3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    263803 (Pkn3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     263803 (Pkn3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKN family
   263803 (Pkn3)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 263803
NCBI-ProteinID: NP_722500
MGI: 2388285
Ensembl: ENSMUSG00000026785
Vega: OTTMUSG00000016746
UniProt: Q8K045
Position
2; 2 B
AA seq 878 aa
MEHRKPGTGQRAPKDEKEMVRRAIQKELKIKEGMENMRRVATDRRHLGHVQQLLRASNRR
LEQLHGELRELHAQVLLPASAEPVTSEPQPRAEQSRARLSEALHRQLQVELKVKQGAENM
IHTCASGTPKERKLLAAAQQMLKDSQLKVALLRMKISSLESSGSPEPGPDLLAEELQHRL
RVEAAVAAGAKNVVKLLGGQRMQDRKALAEAQAQLQESSQKLDLLRLALELLLERLPPTH
SLRSRVTQELWMAMLGNPQPLGTLVKPIALTGTLQVRLLGCKDLLVAVPGRSPMAVLAGS
PSESWLRTRSRQQRGGGELASEVLAVLKVDNRVVGQTGWGLVAEKSWDQSFIISLDRARE
LEIGVHWRDWRQLCGVAFLKLEDFLDNACHQLSLSLVPQGRLFAQVTFCEPVIERRPRLQ
RQRCIFSKRRGRDFMRASQMNLSMAAWGRLVMSLLPPCSSPNTASPPKGRPSTAVCGTPS
AASPSNFLPMKTLSKEDTKPPPKPPRLYLQEPAPGTPCTKRPHMDPRPAVVPALAALSTR
KPPRLQDFRCLAVLGRGHFGKVLLVQYKGTGKYYAIKALKKQEVLGRDEIDSLYCEKRIL
ETVGRTGHPFLLSLLACLQTSSHACFVTEFLPGGDLMAQIHEDVFPEPQACFYLACVVLG
LQFLHEKRIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVL
TQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFECIVSADVPCPHFLSVQGLELIQ
KLLQKSPEKRLGAGERDAEEIKVQPFFRTTNWQALLARTVQPPFVPTLCGPADLRYFEGE
FTSLPPTLTPPVSQSSLTARQQAAFRDFDFVSEQFLES
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggaacaccgaaagcctgggactggccagagagcccccaaggatgagaaagagatggtc
cgccgagccatccagaaggagctgaagatcaaggagggcatggagaacatgcggcgcgtg
gccacagaccgacgccacctgggtcatgtgcagcaactgcttagggcctccaaccgccgc
ctggagcagctgcatggcgagcttcgggagctgcatgcccaagttctgctgccagcctca
gccgagccagtgacctcggaaccccagccgcgggcggagcagtccagggctcggctctcg
gaggctttacataggcagctgcaggtagagctaaaggtaaagcagggggctgagaatatg
attcacacgtgtgccagcggcacccccaaggagaggaagctcctggcggctgcccagcag
atgttaaaggacagtcaactgaaggtggccctgctccggatgaagataagcagcctggag
tccagtggctctccagagccaggccccgacttgctggcagaggagctgcagcaccgactt
cgagtagaggctgctgtggctgcaggtgccaagaatgtggtgaagctgcttggtggccag
aggatgcaggaccgaaaggcactggccgaggcccaggcccagctccaggaatcctcccag
aagctggacctcctacggctggccctggaattgctgctggagaggttgcctcccacccac
tctctacgtagcagggtgacccaagaactttggatggcaatgcttgggaacccccaacct
ttggggacacttgtgaaacctattgccttgacagggacactgcaggttcgcctcctgggc
tgcaaagatctgctggtagctgtgcctggacggtctcccatggctgtcctggcaggtagc
ccttctgaaagctggctccgaacaaggtcccggcagcagcgtggtggaggcgaactggcc
agtgaggtactggctgtgttgaaggttgacaatcgtgttgtgggccagacaggatgggga
ctggtggctgagaaatcctgggaccagagttttatcatctccttggaccgagctcgcgag
ctggagattggggttcactggcgggactggcgacagttgtgtggtgtggcgtttctgaag
cttgaggacttcctggacaatgcctgtcaccagctttctctcagtctggtgcctcagggg
cggctctttgcccaggtcaccttctgcgagcctgtcattgaaaggaggcctcggctgcag
aggcagagatgcattttctctaagcggagaggccgggatttcatgagagcttcccagatg
aacctcagcatggcagcctgggggcgtctggtcatgagcttgctgcccccctgcagctca
ccaaacacagccagtccccctaaagggcgcccttcaacagcggtctgtgggacccccagt
gctgcttccccgagtaacttcctgcccatgaagacgctctcaaaagaagacacgaagcct
cctcccaagcccccgcgcctctatctccaagaaccagccccagggactccttgtaccaag
cgcccccacatggaccctagacctgcagtagtgcccgccctggcagccttatccacaagg
aaaccccccagacttcaagacttccgatgtttggctgtgctgggtcggggacactttggg
aaggtcctcctggtccagtacaaaggaacagggaaatactacgctatcaaggcgttgaag
aagcaggaagtgctaggccgggatgagattgacagcctatactgtgagaagcggatcctg
gagactgtggggcgtacagggcaccccttcctgctctctctccttgcctgtctgcagacc
tccagccatgcctgctttgttactgagtttctgcccggaggagacctcatggcgcagatt
catgaggatgtctttcctgagccccaggcctgcttctacctggcctgtgtggttctgggg
ctgcagttcctacacgagaagaggatcatttacagggatctgaaattggataatctgcta
ctggatgcccagggtttcctcaagattgcagactttggactatgcaaggaaggaattggc
tttggtgaccggaccagcacgttctgtggcaccccggagttcctggcccccgaggttttg
actcaggaggcttacacgcgtgctgtggactggtgggggctgggtgtgctgctctatgag
atgttagtgggtgagtgtccattcccgggggacacagaagaggaggtatttgaatgcatc
gtcagtgctgatgtcccatgtccccactttctgtcagtgcaagggctcgaactcattcag
aagctcctccagaagtccccagagaagcgtctaggggcaggagaacgggacgccgaggag
atcaaggttcaaccattcttcaggaccaccaactggcaggccttgctggcccgcaccgtc
cagcctcccttcgtgcctactctctgtggccctgcagaccttcgttacttcgagggagag
ttcaccagcctgcctccaaccctgaccccaccagtctcccagagctccctcactgctcgc
caacaggctgccttccgggactttgacttcgtgtctgagcagttcctggagtcctga

KEGG   Mus musculus (mouse): 320795
Entry
320795            CDS       T01002                                 

Gene name
Pkn1, DBK, F730027O18Rik, P, PA, PAK1, PR, PRK1, Pkn, Prk, Prkcl1, Stk, Stk3
Definition
(RefSeq) protein kinase N1
  KO
K06071  serine/threonine-protein kinase N1 [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    320795 (Pkn1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    320795 (Pkn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    320795 (Pkn1)
   05135 Yersinia infection
    320795 (Pkn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    320795 (Pkn1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     320795 (Pkn1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKN family
   320795 (Pkn1)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like PL48 Uds1 C2
Other DBs
NCBI-GeneID: 320795
NCBI-ProteinID: NP_796236
MGI: 108022
Ensembl: ENSMUSG00000057672
Vega: OTTMUSG00000025931
UniProt: P70268
Position
8 C2; 8 40.22 cM
AA seq 946 aa
MAGDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEGAENLR
RATTDLGRSLAPVELLLRGSARRLDLLHQQLQELHAHVVLPDPAAGSDATQSLAEGSPIC
SSTNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSSKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQALQAGELESQAAPDEAQGDPELGAVELRIEELRHHFRVEHAVAEGAKNVLR
LLSGAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPADHPKGRLLREELTAASS
SAFSAILPGPFPATHYSTLSKPAPLTGTLEVRVVGCKNLPETIPWSPPPSVGASGTPESR
TPFLSRPARGLYSRSGSLSGRSSLRGEAENATEVSTVLKLDNTVVGQTAWKPCGPNAWDQ
SFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFR
NPIIERIPRLQRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPSAVATGTFSPNAS
PGAEIRHTGDISMEKLNLGADSDSSSQKSPPGLPSTSCSLSSPTHESTTSPELPSETQET
PGPGLCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDE
VESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR
AVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFC
GTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPR
FLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLS
GRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAGGY
NT seq 2841 nt   +upstreamnt  +downstreamnt
atggccggcgacgccgtacagagtgagcctcgaagctggtcgctgctggaacagctgggt
ctggctggggctgacctggcagcccccggggtgcagcaacagctggagttagagcgagag
cgactgaagcgggagatacggaaggagctgaagctgaaggagggcgctgagaacctgagg
cgagccaccactgacctgggccgtagcctggcccctgtggagctgctgctgcggggctcc
gctcgacgcctagacttactgcaccagcagctgcaggagctgcatgcacatgtggtgctg
cctgaccctgcagctggaagcgatgctacccaatcccttgcagagggcagccctatctgc
tcatccaccaacctgagcagagtggctgggctggagaagcagctggccattgagctcaag
gtcaaacagggggcagagaacatgatccagacctatagcaatggcagcagcaaggaccgg
aagctgttgttgacagcccagcagatgctgcaggacagtaagaccaagattgacatcatc
cgcatgcagcttcgaagagcgctccaggcactacaggctggagagctggagagtcaggca
gctcctgatgaagcccaaggagatccagaactgggagccgtagagctacgcattgaggag
ctacgacaccattttcgagtggagcatgcagtggcagaaggtgccaagaatgtcctgcgc
ctgctcagtggggcaaaggccccagaccgcaaggcagtcagcgaggctcaggagaaattg
actgagtccaaccagaagctgggcttgctgcgggaatcactggagaggcgccttggggag
ttgcctgccgatcaccccaaggggcggctgcttcgggaggagctcactgcagcctcgtcc
tcagccttcagcgccatactgcctgggcccttccctgccactcactacagcaccttgagc
aagcctgcaccgctcacagggaccctggaagtacgagtggtgggctgcaaaaaccttccc
gagaccatcccctggagccctcccccctcagtgggggcatctgggacccccgaaagccgc
actccgttcctgagtcgccccgctcggggcctttacagccggagtggaagccttagtgga
cggagcagcctcagaggggaggcagagaatgccactgaggtcagcaccgtgctcaagctg
gacaacacagtggtggggcaaacagcctggaagccatgcggccccaatgcctgggaccag
agctttaccctggagctggagagggctcgggagctggagctggctgtgttctggcgagac
cagaggggtctgtgtgctctcaaatttctgaagttggaggacttcttggacaacgagagg
catgaggtgcagctggacatggaaccccagggctgcctggtggctgaggtcactttccga
aaccccatcatcgagcggatccctaggctccaaaggcagaaaaaaatcttctccaagcag
caagggaaggcatttcagcgagccagacagatgaacatagatgtggcgacttgggtgcgg
ctgctccgtagactcatccctagtgctgtggccactggcaccttcagtcccaatgcatct
ccaggtgctgagatccggcacactggagacatatccatggagaaattgaatctcggtgct
gactcagacagctcgtcccaaaagagcccaccagggctgccctccacctcatgcagcctg
agttctccaacccatgaatccaccacatctccagagctgccttcagagacccaggagact
ccaggccctggcctgtgcagccccttgagaaagtcgcccctgacacttgaggacttcaag
ttcctggccgtgcttggccggggtcactttggaaaggtgctgctgtctgaattccgctcc
agtggggagctctttgccatcaaagccttgaagaaaggtgacattgtagcccgagatgag
gttgagagcctgatgtgtgagaagcggattttggcggccgtgaccagggcaggacatccc
ttcctggtgaaccttttcggctgtttccagaccccagagcacgtgtgctttgtgatggag
tactcggcgggtggagacctgatgctgcacattcatagcgacgtgttctcagagcctcgg
gctgtcttctattcggcctgtgtggtgctgggactgcagttcctccatgaacacaagatt
gtctacagggacctgaagttggacaatttgctcctggatactgagggctacgtcaagatc
gcagactttggcctctgcaaggaggggatgggctatggggaccggaccagcacgttctgc
ggaactccggagttcctggcgccggaagtgctcacagacacatcctacacgcgagcagtg
gactggtggggactgggcgtgctgctctatgagatgttggttggagagtctccgttccct
ggggatgatgaggaggaggtatttgacagcattgtcaacgacgaagttcgctatccccgc
ttcctgtctgcagaggccatcggcatcatgagaaggctactgcggaggaacccggagcgg
aggctggggtccactgagcgcgatgcagaagatgtgaaaaaacagcctttcttccggtct
ctgggctgggatgtcctgctggcccgccgcttgcctccacccttcgtgcctacactttca
gggcgcacagatgtcagcaacttcgatgaggagttcactggggaggcccccacactgagt
cctccccgggatgcacggcccctcacagctgcggagcaggcagccttccgggatttcgac
tttgtggccggaggctactag

DBGET integrated database retrieval system