KEGG   Mus musculus (mouse): 109652
Entry
109652            CDS       T01002                                 

Symbol
Acy1, 1110014J22Rik, Acy-1
Name
(RefSeq) aminoacylase 1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu01100  Metabolic pathways
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109652 (Acy1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    109652 (Acy1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    109652 (Acy1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     109652 (Acy1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M20
   109652 (Acy1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109652 (Acy1)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 GRIP
Other DBs
NCBI-GeneID: 109652
NCBI-ProteinID: NP_001263371
MGI: 87913
Ensembl: ENSMUSG00000023262
Vega: OTTMUSG00000049425
UniProt: Q99JW2 A0A0R4J050
Position
9:complement(106310180..106315594)
AA seq 408 aa
MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVI
TVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQ
YLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANP
TDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQAN
PHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEG
VTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPAL
GFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPSES
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaccaccaaggatcccgagtctgagcacccctccgtgacgctcttccgccagtacctg
cgcatctgcactgtgcaacccaatccagactatggaggggccatcaccttcctggaggag
agagcccgccagctgggtctgagctgtcagaaaatagaggtggtgcctggctttgtgatc
actgtgctgacctggccaggcaccaacccgtcactcccctccatcttgctaaactcccac
acagatgtggtacctgtcttcaaggaacattggcatcacgacccctttgaggccttcaag
gattccgagggctacatctatgctaggggctcccaggacatgaagagtgtcagcatccag
tacctggaagctgtgaggaggctgaagagcgagggccaccgattccctaggaccatccac
atgacctttgtgcctgacgaggaggtcggaggtcacaaggggatggagttgtttgtgaag
aggcctgagttccaggctctgcgggcaggcttcgttctggacgagggcctggccaacccc
acggatgcctttactgtcttttatagtgagcggagtccttggtgggtacaggttaccagc
actgggaagccaggccatgcctcacgcttcattgaggatacagctgcagagaagttgcat
aaggttataagctccatcttggcattccgggagaaggaaaggcagaggctgcaggcgaac
cctcacctgaaggaaggcgccgtgacttcggtgaatctgaccaagcttgaaggtggcgtg
gcctataatgtggtacctgccactatgagtgccagctttgacttccgagtggcaccagat
gtagacatgaaggccttcgagaagcagctgcagagatggtgccaggaagcaggagagggg
gtcacctttgagtttgctcagaagtttacagagcctcgaatgacacccacggatgattca
gatccctggtgggcagctttcagcggagcctgcaaggcaatgaacctcactctggagcca
gagatctttcctgctgccactgacagccgctttatccgggcggtggggatcccagctctg
ggcttctcgcccatgaaccgcacacctgtcctgctacatgaccataatgaacggctgcat
gaggatatatttctccgtggggttgacatatatacaggcctcctctctgcacttgctagt
gtgcccaccctgcctagtgaaagctga

DBGET integrated database retrieval system