KEGG   Mus musculus (mouse): 109660
Entry
109660            CDS       T01002                                 

Gene name
Ctrl, 0910001G08Rik, 1810004D15Rik, AV005227, Ctr, Ctra, Ctra-1, Ctra1, chym, chymopasin, mFLJ00366
Definition
(RefSeq) chymotrypsin-like
  KO
K09632  chymotrypsin-like protease [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04972  Pancreatic secretion
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    109660 (Ctrl)
   04974 Protein digestion and absorption
    109660 (Ctrl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    109660 (Ctrl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109660 (Ctrl)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109660 (Ctrl)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316 Peptidase_C37 He_PIG Pico_P2A
Other DBs
NCBI-GeneID: 109660
NCBI-ProteinID: NP_075671
MGI: 88558
Ensembl: ENSMUSG00000031896
Vega: OTTMUSG00000062063
UniProt: Q9ER05
Position
8 D3; 8 53.06 cM
AA seq 264 aa
MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFC
GGSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSNAEPVQVLSIARAITHPNWNANTMNN
DLTLLKLASPARYTAQVSPVCLASTNEALPSGLTCVTTGWGRISGVGNVTPARLQQVVLP
LVTVNQCRQYWGARITDAMICAGGSGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
IQAPAMYTRVSKFSTWINQVMAYN
NT seq 795 nt   +upstreamnt  +downstreamnt
atgctactgctcagcctaacccttagcctggtcctccttggctcctcctggggctgtggt
gttcctgccatcacgcctgcactgagctacaatcagagaattgtcaacggggagaatgca
gtgccaggctcctggccctggcaggtgtctctccaggataacaccggcttccacttctgc
ggtggttctctcatcagtccgaactgggtggtcacggctgcccactgccaagtcacgcct
ggacgccactttgtcgttttgggagaatatgaccgatcttccaatgctgaacctgtgcag
gtcctctcgatcgcaagggccatcacacaccctaactggaacgccaacaccatgaacaat
gacctgactctcctgaagcttgcctcgccagcccggtacacagcacaagtctcaccagtc
tgcctggcttccacaaacgaggcactgccttcggggctcacctgtgtcaccactggctgg
ggccgaatcagtggtgtgggcaatgtgacaccagctcgcctgcagcaagttgttctaccc
ctggtcactgtgaatcagtgtcggcagtactggggtgcacgcattaccgatgccatgata
tgtgcaggtggctcaggcgcctcctcatgtcagggtgactcaggaggccctcttgtctgc
cagaagggaaacacctgggtgcttattgggattgtctcctggggcactaagaactgcaac
atacaagcaccggccatgtacactcgggtcagcaagttcagtacctggatcaaccaagtc
atggcctacaactaa

DBGET integrated database retrieval system