KEGG   Mus musculus (house mouse): 109672
Entry
109672            CDS       T01002                                 
Symbol
Cyb5a, 0610009N12Rik, Cyb5
Name
(RefSeq) cytochrome b5 type A (microsomal)
  KO
K23490  cytochrome b5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    109672 (Cyb5a)
SSDB
Motif
Pfam: Cyt-b5
Other DBs
NCBI-GeneID: 109672
NCBI-ProteinID: NP_001335088
MGI: 1926952
Ensembl: ENSMUSG00000024646
UniProt: Q544Z9 G5E850
Position
18:84869463..84897996
AA seq 98 aa
MAGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSES
NT seq 297 nt   +upstreamnt  +downstreamnt
atggccgggcagtcagacaaggatgtgaagtactacaccctggaagagattcagaagcac
aaagacagcaagagcacctgggtgatcctgcatcataaggtgtacgatctgaccaagttt
ctcgaagagcatcctggtggagaagaagtcctaagagagcaagctgggggtgatgctacc
gagaattttgaggacgtcgggcactctacggatgcacgagaactgtccaaaacatacatc
atcggggaactccatccagatgacagatcaaagatagccaagccttcggaatcttaa

DBGET integrated database retrieval system