KEGG   Mus musculus (mouse): 109674
Entry
109674            CDS       T01002                                 

Gene name
Ampd2, 1200014F01Rik, AI552571, Ampd, Ampd-2, m4521Da, m4521Dajl
Definition
(RefSeq) adenosine monophosphate deaminase 2
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109674 (Ampd2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     109674 (Ampd2)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 109674
NCBI-ProteinID: NP_001276648
MGI: 88016
Ensembl: ENSMUSG00000027889
Vega: OTTMUSG00000007186
UniProt: Q9DBT5
Position
3 F2.3; 3 46.83 cM
AA seq 798 aa
MASEARSGLGASPLQSARSLPGNAPCLKHFPLDLRTSMDGKCKEIAEELFSRSLAESELR
SAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQG
EGQGDRGLWERDVVLEREFQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQ
SFCPTTRRYLQQLAEKPLETRTYEQSPDTPVSADAPVHPPALEQHPYEHCEPSAMPGDLG
LGLRMVRGVVHVYTRRDPDEHCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQ
YLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKR
HLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGES
VLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVN
HKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEH
VDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFH
TFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSL
FLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARN
SVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQS
EMLETIPEEVGIVMSPGP
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggcctcagaagctcgaagcggtctgggggcctctccgctacagtctgcccgatccctg
ccaggcaacgccccttgcctcaagcacttcccgcttgacctgcgcacgtctatggatggc
aaatgcaaggagatcgctgaggagttgttcagccgctcactggctgagagtgagcttcgt
agcgccccttatgagttcccagaggaaagccccatcgagcagctagaagaacggaggcag
cggctggagcgccagatcagccaggatgtcaagctggagccagatattcttcttcgagcc
aagcaagatttcctgaagacagacagcgactcagacttacagctgtacaaggagcaagga
gagggacagggtgacaggggtctttgggaacgtgatgtggtattggaacgggaatttcag
cgggtcatcatctctggggaggagaagtgtggggtgccattcacagacctcttagacgca
gccaaaagtgtggttcgggcacttttcatccgggagaagtacatggccctatcactgcag
agcttctgtcccaccacccgccgttacctgcagcagctggctgagaagcccctggagact
cgaacttatgagcagagtcctgatacccctgtatctgctgatgccccagtgcatccccct
gcactggagcagcacccgtatgagcactgtgagccaagcgccatgcctggggacctgggc
ttgggtctgcgcatggtgcgtggtgtggtgcacgtctacacccgcagggaccctgatgag
cactgtccggaggtggagcttccataccctgacctacaggaatttgtagctgacgtcaat
gtgctgatggccctgatcatcaatggtcccataaagtcattctgctaccgccggctgcag
tacctgagctccaaattccagatgcacgttttgctcaatgagatgaaggagctcgctgct
cagaagaaagtgccacaccgggacttctacaatatccgtaaggtggacacacacatccac
gcctcgtcctgcatgaaccagaaacatctactgcgcttcatcaagcgggccatgaagcgg
cacctggaggagattgtgcatgtggaacagggccgcgagcagacgctgagagaagtcttc
gagagcatgaacctcactgcctacgacttaagtgtggacacgctggatgtgcatgcggac
aggaatacctttcatcgatttgacaaattcaatgccaaatacaaccctattggggagtct
gttctccgagagatcttcattaaaaccgacaacaagatttctgggaagtactttgctcac
atcatcaaggaggtgatggcagacttggaggagagcaaataccagaatgcagagctccgg
ctgtccatctacgggcgttcgagggatgagtgggacaagctggcacgctgggcagtgaac
cacaaagtgcactctcccaatgtccgctggctggtgcaggtgccccgcctcttcgatgtg
taccgcaccaagggccagctggccaacttccaagagatgctggagaacatctttctgccc
ctgtttgaggctactgtgcaccctgccagccacccggagctgcacctctttctggagcac
gtggatggttttgatagcgtggatgatgagtccaagccagagaaccacgtcttcaacctg
gagagtcccctcccagaagcttgggtggaggaggacaaccctccctatgcctactacctg
tactacaccttcgctaacatggctatgttgaaccatctgcgcaggcagagaggtttccac
acgttcgtgctgaggccgcactgtggggaggccgggcccatccaccacctggtatcagcc
ttcatgctggccgagaacatctcccacgggctgctcctgcgcaaggcccccgtcctgcag
tacctgtattacctggctcagatcggcatcgccatgtccccgctcagcaacaacagcctg
ttcctcagctaccaccggaaccctctccctgagtacttgtcccgtggcctcatggtctcg
ctgtccacagatgatcccttgcagttccacttcaccaaggagcccctgatggaggagtac
agcatcgccacccaggtgtggaagctcagctcctgcgatatgtgcgagctggcccgtaac
agcgtgctcatgagtggcttctctcacaaggtgaaaagccactggctgggacccaactat
accaaggagggccctgagggcaatgatatccgccgtaccaacgtgccagacatccgagtg
ggctaccgctatgagacgctatgccaggagctggcacttatcacacaggccgtccaaagt
gagatgctggagaccatcccagaggaagtgggcattgtcatgagcccagggccttag

DBGET integrated database retrieval system