KEGG   Mus musculus (mouse): 109676Help
Entry
109676            CDS       T01002                                 

Gene name
Ank2, 100043364, AI835472, AW491075, Ank-2, Gm4392
Definition
(RefSeq) ankyrin 2, brain
  KO
K10380  ankyrin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109676 (Ank2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    109676 (Ank2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    109676 (Ank2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA_2 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 109676
NCBI-ProteinID: NP_848770
MGI: 88025
Ensembl: ENSMUSG00000032826
Vega: OTTMUSG00000043348
UniProt: Q8C8R3
Position
3 G2; 3 56.07 cM
AA seq 1050 aa AA seqDB search
MTEVLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDS
LRSFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVA
LSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMP
PMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCD
YTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVL
SSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHK
PITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSF
TTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTD
DKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRL
PLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYAKESESDQEPEEEIGM
TSEKNPQDEQERMEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHAL
LKYWLERDGKHATDTILIECLTKINRMDIVHLLETNTEPLQERMGRSYAEIEQTITLDHS
EGFSVLPDELCAAKEKKEQEASKESESSDHPPMVSEEDISVGYSTFQDCLPKTEGDSPAA
ALSPQMHQEPVQQDFSGKTQDQQEYYVTTPGAEVEDPQKATAVPDSLCKTPEDISTPPEG
TKPCLQTPVTSERGSPIVQEPEEASEPKEESSPRKTSLVIVESTDDQSQVFERLDGDAAF
QKGDDMPDIPPETVTEEEYVDENGHTVVKKVTRKIIRRYVSSDGTEKEEVTMQGMPQEPV
NIEDGDNYSKVIKRVVLKSDTQQSEVTLSEPSVLSSTSQFQAEPVEGRRVSKVVKTTMVH
GERMEKSLGDSSLATDLPSAKDDFEEDNNE
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggtccttgatgtttctgatgaagagggtgatgacactgtgacaggtgatggg
ggagaatacctcaggccagaagatctcaaggagctcggagatgactcactgcccagcagt
cagttcctggatggcatgaactaccttcggtacagtctggagggaggaagatccgacagc
ctccggtccttcagttccgacaggtctcacactctgagccatgcatcgtacctgagggac
agtgccatgattgacgacacggttgtgatccccagccaccaggtgtctgcgctagccaag
gaggcagaaaggaattcttatcgtctgagctggggcactgagaacttagacaacgtggct
ctttcttccagtcctattcattcaggtttcctagtcagttttatggtggatgcccgtggt
ggtgccatgcgaggatgcagacacaatggactcagaatcattatcccacctcggaaatgc
acagccccaactcgcgtcacctgccgccttgtgaaacgccatcgactggcaacaatgccg
cccatggtggaaggagaaggcctggccagccgcctgattgaagtcggaccttcgggagct
cagtttcttgggcccgtgatcgtggagatccctcacttcgccgctcttcgaggaaaggag
agggagctggtggtcctgcgcagtgaaaatggggacagctggaaagagcatttctgcgac
tacactgaggatgaattgaacgaaatccttaatggcatggatgaagtgctggacagtcca
gaagacctggaaaagaaacgaatctgccgcatcatcactcgtgacttcccacagtacttt
gcggtggtgtctcgcatcaaacaggacagcaacctgattggccccgagggtggagtactg
agcagcacagtggtgtcacaggtgcaagccgtcttcccagagggcgcactcaccaagcgc
attcgagtaggcctacaggctcaacctatgcatagtgaattggtaaagaagatcttaggc
aacaaagccaccttcagcccaatagtcactttggaacccaggagaagaaaattccacaag
ccaattactatgactattcctgtccccaaagcttcaagtgatgtcatgctgaatggtttt
gggggagacgcaccaaccttaagattactgtgcagcataacaggtggaactacgcctgcc
cagtgggaagacatcacaggaacaacgccactaacatttgtcaatgagtgtgtttccttt
acaaccaacgtgtctgccaggttctggctgatagactgtcgacagattcaggagtctgtt
gcctttgcatcacaagtgtatagagaaattatctgtgtgccatatatggccaaatttgta
gtgtttgccaagtcacatgaccccattgaagccaggttgcggtgtttctgtatgacagat
gacaaagtagataagacccttgaacaacaagaaaacttctctgaggtggccaggagcagg
gatgtggaggtattggaaggaaaacctatttatgttgattgttttggcaacctggttcca
ctaaccaagagtggccaacatcatatattcagcttttttgccttcaaagaaaatagactt
cctctctttgtcaaggttcgtgacacaacccaggaaccttgcgggcgactctcatttatg
aaggaacccaaatccacaagaggactggtgcatcaagctatttgcaacttaaacatcacc
ctgccaatttatgccaaggaatcggagtcagatcaagagccggaggaagagatcggtatg
acatccgaaaaaaatccccaagatgagcaggagcggatggaagaaaggctggcttacatc
gctgatcaccttggcttcagctggacagaattagcaagagaactggatttcactgaggag
caaattcaccaaattcgaatcgagaaccccaactcccttcaagatcagagccacgcactg
ctcaagtactggctggagagggatgggaagcatgccacagataccatcctcatcgaatgc
ctcaccaagatcaacaggatggacattgtacatctcctggagaccaacacagagcccctc
caggagcgcatgggccgcagctatgcagaaatagagcagaccattacgctggaccacagt
gaaggattttcagtccttccagacgagctctgtgctgccaaggagaagaaggagcaggaa
gcttccaaagaaagcgagtctagcgaccacccgcccatggtctccgaagaagacatatct
gtcggttattccacatttcaggattgcctccccaaaactgaaggggacagcccagcagca
gcactgtctcctcaaatgcaccaggagccagttcaacaagatttctcagggaaaacgcaa
gaccagcaggaatattatgtaacaacaccaggggcagaagtggaagaccctcagaaggcc
acagccgttcctgactctctctgtaagactcctgaggacatcagtacccctcctgaggga
acaaagccttgtctccagaccccggtgactagcgaacgtggttctccgattgtgcaagaa
cctgaggaggcttccgagcccaaagaggagagttctccaaggaaaactagcctggtcatt
gttgagtcaacagacgaccagtctcaggtctttgaaagactggatggtgatgccgctttt
caaaagggagacgatatgcctgacatacccccagagacggtcacagaggaagaatatgtt
gatgagaatggacacaccgtggtgaagaaggttacccggaaaatcattaggcggtacgtt
tcctctgatggcacagagaaggaggaggttaccatgcagggaatgcctcaggagccagtc
aacattgaggatggggacaattattccaaagtgataaagcgcgtggtattgaagagtgac
acccagcagtcagaggtgactttgtctgaacccagcgttttgtccagtacctcacagttt
caggccgagccagtagaaggccgtagagtcagcaaagttgttaaaacaaccatggtacac
ggagaacggatggagaagagtcttggggactctagcttagccactgaccttccttcagcc
aaagatgactttgaagaggacaacaatgagtaa

DBGET integrated database retrieval system