KEGG   Mus musculus (mouse): 109689
Entry
109689            CDS       T01002                                 

Gene name
Arrb1, 1200006I17Rik, AW208571, G430100A01Rik
Definition
(RefSeq) arrestin, beta 1
  KO
K04439  beta-arrestin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04340  Hedgehog signaling pathway
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109689 (Arrb1)
   04340 Hedgehog signaling pathway
    109689 (Arrb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109689 (Arrb1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    109689 (Arrb1)
  09152 Endocrine system
   04929 GnRH secretion
    109689 (Arrb1)
   04926 Relaxin signaling pathway
    109689 (Arrb1)
   04928 Parathyroid hormone synthesis, secretion and action
    109689 (Arrb1)
  09156 Nervous system
   04728 Dopaminergic synapse
    109689 (Arrb1)
  09157 Sensory system
   04740 Olfactory transduction
    109689 (Arrb1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    109689 (Arrb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    109689 (Arrb1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    109689 (Arrb1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C
Other DBs
NCBI-GeneID: 109689
NCBI-ProteinID: NP_796205
MGI: 99473
Ensembl: ENSMUSG00000018909
Vega: OTTMUSG00000034019
UniProt: Q8BWG8
Position
7 E1; 7 54.09 cM
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacacgagtgttcaagaaggcaagccccaatggaaagctcactgtc
tacctgggaaagcgggactttgtggaccacattgacctcgtggaccccgtggatggtgtg
gtcctggtggatcctgagtatctcaaagaaaggcgagtctacgtgacactgacctgcgcc
ttccggtatggccgggaagacctggatgtcttgggtctgacttttcggaaagacctgttt
gtggccaatgtgcagtccttcccaccggcccccgaggacaagaagccactgacacggcta
caggagcgactcatcaagaagctgggcgagcatgcctgccccttcacctttgagatcccg
ccaaaccttccatgctcagtcactctgcagcctgggcctgaggacacaggaaaggcctgt
ggtgtggattatgaagtcaaagccttctgtgctgagaacctggaggagaagatccacaaa
aggaactctgtgcggctagtcatccggaaggttcagtatgcccctgagagacctggccct
cagcccacggctgagactaccagacagttccttatgtcagacaagcccctacaccttgag
gcatcactggataaggagatctattaccacggagaacccatcagcgttaatgtccacgtc
accaacaacaccaacaagactgtgaagaagatcaagatctcggtgcgccagtatgcagac
atctgtctcttcaacacagctcagtacaagtgcccagtggccatggaggaggctgatgac
aatgtggcacccagctcaacattctgcaaggtctatacgctgactcccttcctggccaac
aaccgagagaagcggggactcgccctcgacgggaagctcaagcatgaggacacgaatctg
gcttccagcacgctgttgcgggaaggtgccaaccgtgaaatcctgggcatcatcgtttcc
tacaaagtcaaggtgaaactggtggtgtcccggggcggcctcttgggagaccttgcatcc
agtgatgtggccgtggagctgccttttaccctaatgcaccccaagcctaaggaggagccc
ccacatcgggaagttccagagagcgagactccagtagacaccaatctcatagagcttgac
accaatgatgacgacattgtatttgaggactttgctcgccagcggctgaaaggcatgaag
gatgacaaggacgaagaggatgacggcaccggctctccgcacctcaacaacagatag

KEGG   Mus musculus (mouse): 216869
Entry
216869            CDS       T01002                                 

Gene name
Arrb2, A, AI326910, AW122872, Arr3
Definition
(RefSeq) arrestin, beta 2
  KO
K04439  beta-arrestin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04340  Hedgehog signaling pathway
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    216869 (Arrb2)
   04340 Hedgehog signaling pathway
    216869 (Arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    216869 (Arrb2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    216869 (Arrb2)
  09152 Endocrine system
   04929 GnRH secretion
    216869 (Arrb2)
   04926 Relaxin signaling pathway
    216869 (Arrb2)
   04928 Parathyroid hormone synthesis, secretion and action
    216869 (Arrb2)
  09156 Nervous system
   04728 Dopaminergic synapse
    216869 (Arrb2)
  09157 Sensory system
   04740 Olfactory transduction
    216869 (Arrb2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    216869 (Arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216869 (Arrb2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    216869 (Arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 216869
NCBI-ProteinID: NP_001258289
MGI: 99474
Ensembl: ENSMUSG00000060216
Vega: OTTMUSG00000006049
UniProt: Q91YI4 A0A158SIT9
Position
11 B3; 11 42.99 cM
AA seq 410 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPG
PQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQY
ADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDT
NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQ
SAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggagaaaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgcgactttgtagatcacctggacaaagtggaccctgtggatggc
gtggtgcttgtggatcctgactacttgaaggaccggaaagtgttcgtgaccctcacctgt
gccttccgctatggccgagaagacctggatgtactgggcctgtctttccgcaaagatctg
ttcatcgccacctaccaggccttcccccccatgcccaacccacctcggccccccacccgc
ctacaggaccgactgctgaagaagttgggccaacacgcccaccccttctttttcacgata
ccccaaaatttgccttgctccgtcacactgcagccaggaccagaggacacagggaaggct
tgtggagtagactttgagattcgagctttctgtgccaaatcaatagaagaaaaaagtcac
aagaggaactctgtgcggcttatcatcagaaaggtacagtttgctcctgagacacccggt
ccccagccctcagctgaaaccacacgccacttcctcatgtctgaccggaggtccctccac
ctagaggcttccctggacaaagagctgtactaccacggggagccccttaatgtcaacgtc
catgtcaccaacaattctgccaagaccgtcaagaagatcagagtgtctgtgagacagtac
gccgacatttgcctcttcagcaccgcgcagtacaagtgtcccgtggctcagctagaacaa
gatgaccaggtgtctcctagttccacgttctgcaaggtgtacaccatcaccccgctgctc
agtgacaaccgagagaagcgtggccttgccttggatgggcagctcaaacatgaagacacc
aacctggcttccagcaccattgtgaaggagggagccaacaaggaggtgctggggatcctg
gtatcctacagggtcaaggtgaagctggtggtgtctcgaggcggagatgtctccgtggag
ctacccttcgtcctaatgcaccccaagccccatgaccacatcacccttcccagaccccag
tcagccccccgggaaacagacgtgcctgtggataccaacctcatcgaattcgataccaac
tatgccacagacgatgacatcgtgtttgaggactttgcccggctccggctgaagggaatg
aaggatgatgactgtgatgaccagttttgctag

DBGET integrated database retrieval system