KEGG   Mus musculus (mouse): 109700
Entry
109700            CDS       T01002                                 

Gene name
Itga1, CD49, CD49A, E130012M19Rik, V, Vla1
Definition
(RefSeq) integrin alpha 1
  KO
K06480  integrin alpha 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109700 (Itga1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109700 (Itga1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109700 (Itga1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109700 (Itga1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109700 (Itga1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109700 (Itga1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109700 (Itga1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109700 (Itga1)
   05414 Dilated cardiomyopathy
    109700 (Itga1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    109700 (Itga1)
   04515 Cell adhesion molecules [BR:mmu04515]
    109700 (Itga1)
   04090 CD molecules [BR:mmu04090]
    109700 (Itga1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109700 (Itga1)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   109700 (Itga1)
CD molecules [BR:mmu04090]
 Proteins
  109700 (Itga1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 LYRIC VWA_3 Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 109700
NCBI-ProteinID: NP_001028400
MGI: 96599
Ensembl: ENSMUSG00000042284
UniProt: Q3V3R4 Q8BPT3
Position
13 D2.2; 13 64.61 cM
AA seq 1179 aa
MVPRRPASLEVTVACIWLLTVILGVCISFNVDVKNSMSFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKARTGDVYKCPVGRERSMPCVKLDLPVNTSIPNVTEIKENMTFGSTLV
TNPKGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVQECSTQLDIVIVLDGS
NSIYPWESVTAFLNDLLKRMDIGPKQTQVGIVQYGANVTHEFNLNKYSSTEEVLVAANKI
GRRGGLQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNYRLKQVIQDCEDE
NIQRFSIAILGHYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKALGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQIVIPHNTT
FQTEPTKMNEPLASYLGYTVNSATIPGDVLYIAGQPRYNHTGQVVIYKMEDGDVNILQTL
SGEQIGSYFGSVLTTIDIDKDSYTDLLLVGAPMYMGTEKEEQGKVYVYAVNQTRFEYQMS
LEPIKQTCCSSLKDNSCTKENKNEPCGARFGTAVAAVKDLNVDGFNDVVIGAPLEDDHAG
AVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAAL
FWARDVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATMCFHVKLKSKEDSVYEADLQ
YRVTLDSLRQISRSFFSGTQERRIQRNLTVRESECIRHSFYMLDKHDFQDSVRVTLDFNL
TDPENGPVLDDALPNSVHGHIPFAKDCGNKERCVSDLTLDVSTTEKNLLIVRSQNDKFNV
SLTVKNKGDSAYNTRTVVQYSPNLIFSGIEEIQKDSCESNQNITCRVGYPFLRTGDVVNF
KIIFQFNTSHLSENAIIHLSATSDSEEPLESLYDNEVNISIPVKYEVGLQFYSSASEHHI
SVAANETVPELINSTKDIGDEINVFYTIRKRGHFPMPELRLAISFPNLTSDGYPVLYPTG
WSSSDNVNCRPRSLEDPLGINSGKKMTISKSEVLKRGTIQDCSTCKIATITCHLLPSDVS
QVNVSLILWKPTFIKAHFSSLNLTIRGELQSENSSLTLSSSNRKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggtccccaggcgtcctgctagcctagaggtcactgtagcctgcatctggcttctcacc
gttatcctaggcgtctgcatctccttcaacgttgatgtcaaaaactccatgagcttcagt
ggtccagtggaggacatgtttggatacaccgttcaacagtatgaaaacgaagaaggcaaa
tgggttcttattggttctcctttagttggccaacccaaagcaagaactggagatgtctat
aagtgtccagttgggagagagagatcaatgccttgtgtgaagttggatttaccagttaac
acatcgattcctaatgtcacagaaataaaggaaaacatgacatttggatcaactttagtc
accaatccgaagggaggatttctggcatgtgggcccttgtatgcctatagatgtggacat
ttgcattatacgactggcatatgttctgatgtcagccctacatttcaagttgtgaactcg
ttcgcccctgtacaagaatgtagcacacagcttgacatagtcatcgtcctagatggctcc
aacagcatctacccctgggaaagtgtcactgcctttttaaacgaccttcttaagaggatg
gacattggccccaaacagacacaggttggaattgtacaatatggagcaaatgtaacacat
gagttcaacctcaataagtattcatccacagaagaggtcctggtggcagcaaacaaaata
ggccgcaggggtggtctccagacgatgacagcccttggaatagacacagccaggaaagag
gcattcactgaagctcggggggccagaaggggagtgaaaaaagtcatggttattgtgact
gatggagaatcgcatgacaactatcgcctgaaacaggtcatccaagactgtgaggatgaa
aacattcagcgattttccatagctatccttggccactataacagggggaacttaagcacc
gaaaaatttgtggaggagataaaatcaatcgcaagtgagcccaccgaaaagcacttcttc
aacgtctcagatgagttggccctggtcactattgttaaagctctgggagaaaggatattt
gctttggaagctacagctgaccagtcagcagcttcgtttgaaatggagatgtctcagacc
ggcttcagtgctcattattcacaggactgggtcatgcttggagctgttggagcctatgac
tggaacggaactgtggtcatgcagaaggctaaccagattgtcatccctcataacaccacc
tttcaaactgagcccaccaagatgaacgagcctcttgcttcttacttgggttacacagtg
aactctgccaccatcccgggagatgtgctctatatcgctgggcagcctcggtacaatcac
accggccaggtcgtcatctacaagatggaggatggggacgtcaacattctgcagacactc
agtggagagcagatcggatcctactttggtagcgtcttaaccacaattgacatcgacaaa
gattcttacactgatctgcttctcgtcggggctcccatgtatatggggacagagaaagag
gaacagggcaaggtgtacgtgtacgctgtgaatcagacgaggtttgaatatcaaatgagc
ctggaaccaattaagcagacctgctgttcatccctgaaggataattcatgcacaaaagaa
aacaagaatgagccctgtggggcccgttttggaacagcagttgctgctgtaaaagacctc
aacgtggatggctttaatgacgtcgtgattggagctcccctggaagacgaccacgcagga
gctgtgtacatttatcatggcagtggcaagaccataaggaaagagtatgcgcaacgcatt
ccctcaggtggggatgggaagacgctgaaattttttggccagtctatccacggagagatg
gatttaaatggcgatggtctgactgacgtgaccattggaggccttggaggagctgccctc
ttctgggccagagatgtggctgtagttaaagtgaccatgaattttgaacccaacaaagtg
aatattcaaaagaaaaactgccgtgtggagggcaaagaaacagtatgcataaatgctaca
atgtgttttcatgtgaaattgaagtctaaagaagactcagtttacgaggctgatctgcag
taccgtgtcacccttgattcgctgaggcagatatcacggagctttttttctggaactcag
gaaaggaggattcaaagaaacctcaccgttcgagaatccgaatgcatcaggcactccttc
tacatgttggataagcacgactttcaggactccgtgagagtgactttggattttaacctc
actgatccagaaaatgggcccgtgctcgatgacgctctgccaaactcagtccatggacat
attccttttgccaaagactgtgggaacaaggaaagatgcgtttcagacctcaccctggat
gtgtccacaacagaaaagaacctgctgattgtcagatcccagaatgacaagttcaatgtc
agcctcaccgtcaaaaacaagggagacagtgcgtacaacacccggacagtggttcagtat
tctccaaatctgattttttcaggaattgaggagatccaaaaagatagctgcgaatccaat
caaaatatcacgtgtagagttggatatcctttcctgaggacaggagacgtggttaacttc
aaaataatattccagtttaatacatcacatctctcagaaaatgcaattattcatttaagt
gcaacaagtgacagtgaagagcccctggaatctctttacgataatgaagtaaatatttcc
atccccgtaaaatatgaagtcggactgcagttttacagttctgcgagtgaacaccacatt
tcagttgctgccaatgagactgttcctgagctgattaattccaccaaggacattggggat
gaaattaatgtcttctacacgattagaaaaagagggcatttcccaatgccagaacttcgg
ctggcaatttcatttcccaatctgacgtcagatggctatcctgtactgtacccaactgga
tggtcatcttctgataatgtaaactgcagacctcgaagccttgaggaccctttgggtatc
aactctgggaagaaaatgacaatatcaaagtctgaggttctcaaaagaggcacaatccag
gactgcagtacctgcaagattgctaccatcacgtgtcatctccttccctcggatgtgagt
caagtgaatgtctcactcatcttgtggaaaccaactttcataaaagcacatttttccagc
ttaaatcttaccatacggggagaacttcagagtgaaaactcatcgctgactttaagcagc
agcaaccggaaacgagagctggctattcagatatccaaagacgggctcccaggccgagtg
ccgctgtgggttatcctcctgagcgcctttgcgggactcctgctgttaatgctgcttata
ttagctctgtggaagattggattcttcaaaaggccactaaagaagaaaatggagaaatga

DBGET integrated database retrieval system