KEGG   Mus musculus (mouse): 109711Help
Entry
109711            CDS       T01002                                 

Gene name
Actn1, 3110023F10Rik, Actn1a
Definition
(RefSeq) actinin, alpha 1
  KO
K05699  actinin alpha 1/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05146  Amoebiasis
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    109711 (Actn1)
   04520 Adherens junction
    109711 (Actn1)
   04530 Tight junction
    109711 (Actn1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    109711 (Actn1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    109711 (Actn1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    109711 (Actn1)
  Immune diseases
   05322 Systemic lupus erythematosus
    109711 (Actn1)
  Infectious diseases
   05146 Amoebiasis
    109711 (Actn1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    109711 (Actn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109711 (Actn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109711 (Actn1)
  Exosomal proteins of colorectal cancer cells
   109711 (Actn1)
  Exosomal proteins of bladder cancer cells
   109711 (Actn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_8 EF-hand_5 XisI
Motif
Other DBs
NCBI-GeneID: 109711
NCBI-ProteinID: NP_598917
MGI: 2137706
Ensembl: ENSMUSG00000015143
UniProt: Q7TPR4
Position
12 C3; 12 36.49 cM
AA seq 892 aa AA seqDB search
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggaccattatgattcccagcagaccaacgactacatgcagcctgaagaggactgggat
cgggacctgctcctggatccggcctgggagaagcagcagaggaagacgttcacagcctgg
tgcaactcccacctgcgcaaagcggggacacagatcgagaacatcgaagaggacttccga
gatggcctgaagctcatgctgctcctggaggtcatctcaggtgaacgcttggccaagcca
gagagaggcaagatgagagtgcacaagatctccaacgtcaacaaggccttggatttcata
gccagcaaaggggtcaagctggtgtccatcggagctgaagaaattgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcattctccgctttgccatccaggacatctcc
gtggaagagacttcagctaaagaagggttactcctgtggtgtcagaggaagacagcccca
tataaaaatgtcaacatccaaaacttccacatcagttggaaagatggtcttggtttctgt
gccttgatccaccgacaccggcccgagttgattgactatggaaagcttcgaaaggatgat
ccactcacaaacctgaacacggcctttgatgtggcagagaggttcctggacatccctaag
atgctggatgctgaagacatcgtcggaactgcccggccagatgagaaagccattatgact
tatgtgtctagcttctatcatgccttctctggagcccagaaggcagaaacagcagccaat
cgcatctgcaaagtgttggcggtcaatcaagagaacgagcagcttatggaagactatgag
aagctggccagtgatctgttggagtggatccgccgcaccatcccatggctggagaatcgg
gtgcctgagaacaccatgcatgccatgcagcagaagctggaggacttccgagactataga
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaactttaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctccgagggcaggatg
gtctcggatatcaacaatgcctggggctgcctggaacaggccgagaagggctacgaggag
tggctgctgaatgagatccggaggctagagaggttggaccacctggcagagaagttccgg
cagaaggcctccatccatgaagcctggacggatggcaaagaagccatgcttcggcagaag
gattatgagacagccaccctgtccgagatcaaggccttgctcaagaagcacgaggctttt
gagagtgatctggctgcccaccaggaccgcgtggagcagattgcggccattgcccaggag
cttaatgagctggactactatgactcgccaagtgtcaacgctcgttgccaaaagatctgt
gaccagtgggacaatctaggggctctcactcagaagcggagggaagctttagagcgaaca
gagaagctgctggaaaccatcgaccagctctacttagagtacgccaagagggctgcaccc
ttcaacaattggatggagggagccatggaggacctgcaggacaccttcatcgtacatacc
atcgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctcccggat
gcagacaaggagcgcctcgccattctgggcatccacaatgaagtgtccaagatcgtccag
acctatcatgtcaacatggcaggcaccaacccctatacaaccatcacgcctcaggagatc
aatggcaaatgggaccatgtacggcagctagtgccccggagggaccaggctctcacagag
gaacatgcaaggcagcagcacaatgagaggctacgcaaacagtttggcgcacaagccaat
gtcattgggccctggatccagaccaagatggaggagattgggaggatttccattgagatg
cacggcaccctggaggaccaactcagccacctgcggcagtatgagaagagcatcgtcaat
tacaagccaaagattgaccagctggagtgcgaccaccagctcatccaggaggcacttatc
tttgacaataagcacaccaactacaacatggagcatatccgtgtgggctgggagcagctg
ctcaccaccattgccaggaccatcaatgaagtggagaaccagatcttgacccgggatgcc
aaaggcatcagccaggaacagatgaacgaattccgcgcctctttcaaccactttgaccgg
gatcactccggcacgttgggtcccgaagagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaggcagagtttgcccgaatcatgagcattgtagac
cccaaccgcttgggggtagtgacgttccaggccttcatcgactttatgtcccgagagacg
gcagatactgatactgcagatcaggtcatggcttccttcaagatcctggctggagataag
aattacatcacagaggatgagctgcgccgtgagctgccccctgaccaagccgagtactgc
atcgcaagaatggccccctacgcgggccccgactccgtgcccggtgctttagactacatg
tccttctccacggcactgtatggcgagagcgacctctaa

DBGET integrated database retrieval system