KEGG   Mus musculus (mouse): 109711
Entry
109711            CDS       T01002                                 

Gene name
Actn1, 3110023F10Rik, Actn1a
Definition
(RefSeq) actinin, alpha 1
  KO
K05699  actinin alpha 1/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05146  Amoebiasis
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109711 (Actn1)
   04520 Adherens junction
    109711 (Actn1)
   04530 Tight junction
    109711 (Actn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109711 (Actn1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109711 (Actn1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109711 (Actn1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109711 (Actn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109711 (Actn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    109711 (Actn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    109711 (Actn1)
   04147 Exosome [BR:mmu04147]
    109711 (Actn1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    109711 (Actn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     109711 (Actn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109711 (Actn1)
  Exosomal proteins of colorectal cancer cells
   109711 (Actn1)
  Exosomal proteins of bladder cancer cells
   109711 (Actn1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_8 EF-hand_5 XisI
Other DBs
NCBI-GeneID: 109711
NCBI-ProteinID: NP_598917
MGI: 2137706
Ensembl: ENSMUSG00000015143
UniProt: Q7TPR4
Structure
PDB: 
6C0A

Position
12 C3; 12 36.49 cM
AA seq 892 aa
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggaccattatgattcccagcagaccaacgactacatgcagcctgaagaggactgggat
cgggacctgctcctggatccggcctgggagaagcagcagaggaagacgttcacagcctgg
tgcaactcccacctgcgcaaagcggggacacagatcgagaacatcgaagaggacttccga
gatggcctgaagctcatgctgctcctggaggtcatctcaggtgaacgcttggccaagcca
gagagaggcaagatgagagtgcacaagatctccaacgtcaacaaggccttggatttcata
gccagcaaaggggtcaagctggtgtccatcggagctgaagaaattgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcattctccgctttgccatccaggacatctcc
gtggaagagacttcagctaaagaagggttactcctgtggtgtcagaggaagacagcccca
tataaaaatgtcaacatccaaaacttccacatcagttggaaagatggtcttggtttctgt
gccttgatccaccgacaccggcccgagttgattgactatggaaagcttcgaaaggatgat
ccactcacaaacctgaacacggcctttgatgtggcagagaggttcctggacatccctaag
atgctggatgctgaagacatcgtcggaactgcccggccagatgagaaagccattatgact
tatgtgtctagcttctatcatgccttctctggagcccagaaggcagaaacagcagccaat
cgcatctgcaaagtgttggcggtcaatcaagagaacgagcagcttatggaagactatgag
aagctggccagtgatctgttggagtggatccgccgcaccatcccatggctggagaatcgg
gtgcctgagaacaccatgcatgccatgcagcagaagctggaggacttccgagactataga
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaactttaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctccgagggcaggatg
gtctcggatatcaacaatgcctggggctgcctggaacaggccgagaagggctacgaggag
tggctgctgaatgagatccggaggctagagaggttggaccacctggcagagaagttccgg
cagaaggcctccatccatgaagcctggacggatggcaaagaagccatgcttcggcagaag
gattatgagacagccaccctgtccgagatcaaggccttgctcaagaagcacgaggctttt
gagagtgatctggctgcccaccaggaccgcgtggagcagattgcggccattgcccaggag
cttaatgagctggactactatgactcgccaagtgtcaacgctcgttgccaaaagatctgt
gaccagtgggacaatctaggggctctcactcagaagcggagggaagctttagagcgaaca
gagaagctgctggaaaccatcgaccagctctacttagagtacgccaagagggctgcaccc
ttcaacaattggatggagggagccatggaggacctgcaggacaccttcatcgtacatacc
atcgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctcccggat
gcagacaaggagcgcctcgccattctgggcatccacaatgaagtgtccaagatcgtccag
acctatcatgtcaacatggcaggcaccaacccctatacaaccatcacgcctcaggagatc
aatggcaaatgggaccatgtacggcagctagtgccccggagggaccaggctctcacagag
gaacatgcaaggcagcagcacaatgagaggctacgcaaacagtttggcgcacaagccaat
gtcattgggccctggatccagaccaagatggaggagattgggaggatttccattgagatg
cacggcaccctggaggaccaactcagccacctgcggcagtatgagaagagcatcgtcaat
tacaagccaaagattgaccagctggagtgcgaccaccagctcatccaggaggcacttatc
tttgacaataagcacaccaactacaacatggagcatatccgtgtgggctgggagcagctg
ctcaccaccattgccaggaccatcaatgaagtggagaaccagatcttgacccgggatgcc
aaaggcatcagccaggaacagatgaacgaattccgcgcctctttcaaccactttgaccgg
gatcactccggcacgttgggtcccgaagagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaggcagagtttgcccgaatcatgagcattgtagac
cccaaccgcttgggggtagtgacgttccaggccttcatcgactttatgtcccgagagacg
gcagatactgatactgcagatcaggtcatggcttccttcaagatcctggctggagataag
aattacatcacagaggatgagctgcgccgtgagctgccccctgaccaagccgagtactgc
atcgcaagaatggccccctacgcgggccccgactccgtgcccggtgctttagactacatg
tccttctccacggcactgtatggcgagagcgacctctaa

KEGG   Mus musculus (mouse): 60595
Entry
60595             CDS       T01002                                 

Gene name
Actn4, C77391
Definition
(RefSeq) actinin alpha 4
  KO
K05699  actinin alpha 1/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05146  Amoebiasis
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    60595 (Actn4)
   04520 Adherens junction
    60595 (Actn4)
   04530 Tight junction
    60595 (Actn4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60595 (Actn4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    60595 (Actn4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    60595 (Actn4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    60595 (Actn4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    60595 (Actn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    60595 (Actn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    60595 (Actn4)
   04147 Exosome [BR:mmu04147]
    60595 (Actn4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    60595 (Actn4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     60595 (Actn4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   60595 (Actn4)
  Exosomal proteins of colorectal cancer cells
   60595 (Actn4)
  Exosomal proteins of bladder cancer cells
   60595 (Actn4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 60595
NCBI-ProteinID: NP_068695
MGI: 1890773
Ensembl: ENSMUSG00000054808
Vega: OTTMUSG00000016983
UniProt: P57780 Q3ULT2
Position
7; 7 B1
AA seq 912 aa
MVDYHAANQAYQYGPNSGGGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAW
CNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFI
ASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAP
YKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPK
MLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYE
RLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNT
LQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFR
QKASIHEAWTDGKEAMLKQRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQE
LNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAP
FNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAE
SNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQAN
MVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALI
FDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDK
DHGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRET
TDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYK
SFSTALYGESDL
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggtggactaccacgcagcgaaccaggcgtaccagtacggcccgaacagcggcggcggc
aatggcgcgggtggcggcggaagcatgggcgactacatggcccaggaggatgactgggac
cgggacctgctgttggacccggcctgggagaagcagcagcgcaagaccttcacagcctgg
tgcaactctcatcttcggaaggctggcactcagatcgagaatatcgatgaggacttcagg
gatgggctcaaacttatgcttctgttggaggtcatttcaggggagcgtttgcctaagcca
gagcgggggaagatgcgagtgcacaagatcaacaatgtaaacaaagccctggacttcatc
gccagcaagggagtcaagctggtgtccatcggggcagaagagattgtggatggcaatgca
aagatgaccctgggaatgatctggaccatcatcctcagatttgccatccaggacatctct
gtggaagagacctctgctaaggaaggactcctcctctggtgccagagaaagacagcccca
tataaaaacgtcaacgtccagaacttccatatcagctggaaggacgggctggccttcaat
gcactcatccaccggcacaggcctgagctgattgagtatgacaagctgcggaaggatgat
ccagtcaccaacctaaacaatgcatttgaagtggctgagaaatacctcgatatccccaag
atgttggatgctgaggacatcgtgaacacagcccggcccgacgagaaggccataatgaca
tatgtgtccagcttctaccatgccttttcaggagcgcagaaggctgagaccgctgccaac
cggatctgcaaggtgctggctgtgaaccaggaaaatgagcacctgatggaagactatgaa
cgcctggccagtgatcttctagagtggattcggcgcaccatcccctggctggaggaccgg
gtgcctcagaagaccatccaggaaatgcagcagaagctggaggacttccgagactatagg
cgtgtgcacaagccgcccaaggtgcaggagaagtgtcagctggagatcaacttcaacaca
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctccgagggcaggatg
gtctccgacatcaacaatggatggcagcacctggagcaggctgagaagggctatgaagaa
tggctgctgaatgaaatccgtaggctggaacggcttgaccacctggcagagaagttccgg
cagaaggcttccatccacgaggcctggactgatgggaaggaggccatgctgaagcaacgg
gactacgagacagccaccctgtcagacatcaaagctctgatccgaaaacatgaggccttt
gaaagtgacctggctgcacaccaggaccgagtggagcagattgctgcaattgctcaggag
ctcaacgagctggactactatgactcccacaacgtcaacacacggtgccagaagatctgc
gaccagtgggataacctgggctctctgacacacagtcgcagggaagccttggagaaaaca
gagaaacagctagagaccatcgaccagctacatttggagtatgccaagcgggctgcaccc
ttcaacaactggatggagagtgccatggaggacctgcaggacatgttcatcgtccacacc
atcgaggagatcgagggcctgatctcagcccatgaccagttcaagtccaccctgccagat
gctgacagggagcgtgaggccatcctggccatccacaaggaggcccagaggatcgctgag
agcaatcacatcaagctgtcgggcagcaatccctacaccactgttaccccccagatcatc
aactccaagtgggagaaggtgcagcagctggtgccaaagagggaccatgcactcctggag
gagcagagcaagcagcaatccaatgagcaccttcgccgacagttcgccagccaagccaat
atggtggggccgtggatccagaccaagatggaggagatcgggcgcatctccattgagatg
aacgggactctggaagaccagctgagccacctgaagcagtacgagcgcagcatcgtggac
tacaagcccagcctggacctgctggagcagcagcaccagctcatccaggaggccctcatc
ttcgacaacaagcacaccaactacacaatggagcatatccgtgtgggctgggagcagctg
ctcacgaccattgcccgcaccatcaatgaggtggaaaaccagatcctcacccgagatgcc
aagggtatcagccaggagcagatgcaggagttccgggcatccttcaaccattttgacaag
gaccatggcggggcactggggcctgaggaattcaaggcctgcctcatcagcctgggctat
gacgtggagaatgaccggcagggtgatgctgagttcaaccggatcatgagtgtggttgat
cccaaccatagtggcctcgtgaccttccaagccttcattgacttcatgtcaagggagacc
acagacacagacacagctgatcaggtcatcgcctccttcaaggtcctggcaggagacaag
aacttcatcactgctgaggaactgcggagagagctgccccccgaccaggccgagtactgc
atcgcccgcatggcaccctaccaggggcctgatgctgctcctggcgcccttgactacaag
tccttctccacagccctctatggggagagcgacctgtga

DBGET integrated database retrieval system