KEGG   Mus musculus (mouse): 109754
Entry
109754            CDS       T01002                                 

Gene name
Cyb5r3, 0610016L08Rik, 2500002N19Rik, B5R, C85115, Dia-1, Dia1, WU:Cyb5r3
Definition
(RefSeq) cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109754 (Cyb5r3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     109754 (Cyb5r3)
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Other DBs
NCBI-GeneID: 109754
NCBI-ProteinID: NP_084063
MGI: 94893
Ensembl: ENSMUSG00000018042
Vega: OTTMUSG00000030694
UniProt: Q9DCN2
Position
15 E1; 15 39.4 cM
AA seq 301 aa
MGAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRF
RFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPK
FPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAG
GTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVD
KAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFT
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atgggggcccagctgagcacgttgagccacgtggtgctctcgcccgtctggttcatctac
agtctcttcatgaagctgtttcagcgctccacaccggccatcaccctcgagaaccccgac
atcaagtaccctctgaggctcatcgacaaggaggtcatcagtcctgacactcggcgcttc
cgatttgccctcccttcaccccagcacatcctgggccttcctattggccaacacatctac
ctctcgactaggatcgatggcaacttggtcattcggccctacacccctgtgtcgagcgat
gatgacaagggctttgtggacttggtggtcaaggtttacttcaaggacacccatcccaag
tttccagctggagggaaaatgtctcagtacctggaaaacatgaagattggagacaccatt
gaattccggggtcccaatgggctactggtctaccagggcaaagggaagtttgccatccgt
gcagacaagaagtccaaccccgttgtcaggacggtgaagtctgtaggcatgattgcagga
gggacaggcatcaccccaatgctgcaggtgatccgagccgtcctgaaggacccaaacgac
cacaccgtgtgctatctgctctttgccaaccagtccgagaaagatatcctgttgcggcct
gagctggaggaactgaggaacgaacattctgctcgcttcaagctctggtacacagtggac
aaagcccctgatgcctgggactatagccagggcttcgtgaatgaggagatgatcagggac
caccttccaactcctggggaggagccgctgatactgatgtgtggacccccaccaatgatc
cagtttgcctgtttgccaaacctggagcgtgtgggccatcccaaggagcgatgcttcacc
ttctga

DBGET integrated database retrieval system