KEGG   Mus musculus (mouse): 109801
Entry
109801            CDS       T01002                                 

Gene name
Glo1, 0610009E22Rik, 1110008E19Rik, 2510049H23Rik, AW550643, GLY1, Glo-1, Glo-1r, Glo-1s, Glo1-r, Glo1-s, Qglo
Definition
(RefSeq) glyoxalase 1
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109801 (Glo1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     109801 (Glo1)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_6 PIG-X
Other DBs
NCBI-GeneID: 109801
NCBI-ProteinID: NP_001107032
MGI: 95742
Ensembl: ENSMUSG00000024026
UniProt: Q9CPU0 A5GZX3
Structure
PDB: 

Position
17 A3.3; 17 15.69 cM
AA seq 184 aa
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQK
LDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI
ATII
NT seq 555 nt   +upstreamnt  +downstreamnt
atggcagagccacagccggcgtccagtggcctcactgatgagaccgctttcagctgctgc
tccgatccagaccctagcaccaaggattttctactgcagcaaacgatgctaagaattaag
gatcctaagaagtccctggatttttatacgagggttcttggactgaccctcctgcagaag
cttgacttccctgctatgaagttctcgctctacttcttagcttatgaggataagaacgat
atccccaaggacaagtccgagaagacagcatggacgttttccagaaaagccacccttgag
ctcacgcacaactggggcactgaagatgacgagactcagagttaccacaacggcaactcg
gaccctcgtggatttggtcacattgggattgccgttcctgatgtctacagtgcctgtaag
agatttgaagaactaggtgtcaagtttgtgaagaagcctgatgacgggaaaatgaaagga
ctggcgttcattcaagaccctgacggctactggattgagattctgaatcctaacaaaata
gcaacgattatttag

DBGET integrated database retrieval system