KEGG   Mus musculus (mouse): 109815
Entry
109815            CDS       T01002                                 

Gene name
Selenos, 1500011E07Rik, C78786, H-4, H-47, H4, H47, Se, Sels, Seps1, V, Vimp
Definition
(RefSeq) selenoprotein S
  KO
K14025  selenoprotein S
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109815 (Selenos)
SSDB
Motif
Pfam: Selenoprotein_S Aconitase
Other DBs
NCBI-GeneID: 109815
NCBI-ProteinID: NP_077759
MGI: 95994
Ensembl: ENSMUSG00000075701
Vega: OTTMUSG00000021140
UniProt: Q9BCZ4
Position
7 C; 7 35.49 cM
AA seq 190 aa
MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQ
RQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWD
SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG
RRGPSSGGUN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggatcgcgatgaggaacctctgtccgcgaggccggcgctggagaccgagagcctgcga
ttcctgcacgtgacagtgggctccctgctggccagctatggctggtacatcctcttcagc
tgcatcctactctacattgtcatccagaggctctcccttcgactgagggctttgaggcag
agacagctggaccaagccgagactgttctggaacctgatgttgttgttaagcggcaagag
gctttagcagctgctcgtttgagaatgcaggaagatctaaatgcccaagttgaaaaacat
aaggaaaaactaagacagcttgaagaagagaaaagaagacagaagattgaaatgtgggac
agcatgcaagaaggcagaagttacaaaagaaattcaggaaggcctcaggaagaagatggt
cctggaccttctacttcatctgtcatccccaaaggaaaatctgacaaaaagcctttgcga
ggaggtggttataaccctctgacgggtgaagggggtggaacctgctcctggagacctgga
cgcaggggcccatcatctggcggctgaaactaa

DBGET integrated database retrieval system