KEGG   Mus musculus (mouse): 109821
Entry
109821            CDS       T01002                                 

Gene name
F11, 1600027G01Rik, AI503996, Cf11, FX, FXI, PTA
Definition
(RefSeq) coagulation factor XI
  KO
K01323  coagulation factor XI [EC:3.4.21.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109821 (F11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    109821 (F11)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.27  coagulation factor XIa
     109821 (F11)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109821 (F11)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 DUF1986 Trypsin_2 PAN_2 MANEC
Other DBs
NCBI-GeneID: 109821
NCBI-ProteinID: NP_082342
MGI: 99481
Ensembl: ENSMUSG00000031645
Vega: OTTMUSG00000061128
UniProt: Q91Y47
Position
8 B1.1; 8 25.14 cM
AA seq 624 aa
MTSLHQVLYFIFFASVSSECVTKVFKDISFQGGDLSTVFTPSATYCRLVCTHHPRCLLFT
FMAESSSDDPTKWFACILKDSVTEILPMVNMTGAISGYSFKQCPQQLSTCSKDVYVNLDM
KGMNYNSSVVKNARECQERCTDDAHCQFFTYATGYFPSVDHRKMCLLKYTRTGTPTTITK
LNGVVSGFSLKSCGLSNLACIRDIFPNTVLADLNIDSVVAPDAFVCRRICTHHPTCLFFT
FFSQAWPKESQRHLCLLKTSESGLPSTRITKSHALSGFSLQHCRHSVPVFCHPSFYNDTD
FLGEELDIVDVKGQETCQKTCTNNARCQFFTYYPSHRLCNERNRRGRCYLKLSSNGSPTR
ILHGRGGISGYSLRLCKMDNVCTTKINPRVVGGAASVHGEWPWQVTLHISQGHLCGGSII
GNQWILTAAHCFSGIETPKKLRVYGGIVNQSEINEGTAFFRVQEMIIHDQYTTAESGYDI
ALLKLESAMNYTDFQRPICLPSKGDRNAVHTECWVTGWGYTALRGEVQSTLQKAKVPLVS
NEECQTRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYNGVWHLVGITSWGEGCGQ
KERPGVYTNVAKYVDWILEKTQTV
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgacctcattacatcaggtgttatattttatcttttttgcctcagtttctagtgaatgc
gttactaaggtcttcaaagacatcagctttcaaggaggtgacctgagtactgttttcaca
ccgagcgccacatactgccgcttggtctgcactcaccacccacggtgcttgctcttcacg
ttcatggctgagtcatcttcggatgatcctaccaaatggtttgcctgcatcctgaaggac
agcgtcacagaaatattgccaatggtaaacatgacaggcgcgatctctggatattccttc
aagcaatgccctcagcaattaagtacttgcagcaaagatgtgtacgtgaacctagacatg
aagggcatgaactataacagctctgtcgtgaagaatgctcgagaatgccaggagagatgc
acagacgatgcccactgccagtttttcacatacgcaacagggtattttcccagtgtggac
catcgtaaaatgtgtcttttgaagtacacccgaacggggacgccaaccacaataacgaag
ctcaatggcgtggtatctggattttcactgaagtcctgtggactttcaaacttggcttgt
atcagggacattttccctaacacggtgctggcagaccttaacattgacagcgtggtggcc
ccagatgcttttgtctgtcgtcgcatctgcacgcatcaccccacttgtttgttcttcaca
ttcttttcccaagcatggccgaaagaatctcagagacatctttgtctccttaaaacctct
gaaagtggattaccaagcacacgcattacaaagagccacgccctttcgggcttcagtctc
cagcactgcaggcacagtgtcccagtattctgccatccgtccttttacaacgacactgat
ttcttgggagaagagctggacatcgtcgatgtgaaaggccaagaaacctgtcagaaaacg
tgtaccaataacgcccgctgccagttctttacctactatccatcgcacagactgtgcaat
gagaggaaccgcaggggcagatgttacctaaagctttcctccaatggatctccaacgaga
atacttcatgggaggggaggcatctctggatactcactgaggctgtgcaaaatggataat
gtgtgcacaactaaaatcaaccccagagtggtaggaggagctgcgtctgttcacggtgag
tggccatggcaggtgactctgcacatcagccagggacacctgtgtggaggctccatcatt
ggaaaccaatggatactgacagcagctcattgtttctctgggatagagacacctaaaaag
ctgcgtgtctacggtggcattgtaaatcaatcagaaataaatgaagggactgctttcttc
agggttcaagaaatgataattcatgatcagtatacgacagcagaaagtgggtatgatatt
gccctgttaaaactggaatcagccatgaattacacagattttcagcggccaatatgcctg
ccttccaaaggagatagaaacgcagtgcacacagaatgctgggtgactggatgggggtac
acagcactaagaggtgaagtacaaagtactcttcagaaagccaaggttccattggtgtca
aatgaagaatgtcagacaagatacagaagacacaaaataaccaataagatgatctgtgca
ggctacaaagaaggagggaaggatacgtgcaagggagattctggagggcccctgtcctgc
aaatacaatggggtctggcacttggtgggcatcacaagctggggtgaaggctgtggtcag
aaggagagaccgggggtctacacgaacgtggccaagtacgtggactggattctggagaaa
actcaaacagtctga

DBGET integrated database retrieval system