KEGG   Mus musculus (mouse): 109880
Entry
109880            CDS       T01002                                 

Gene name
Braf, 9930012E13Rik, AA120551, AA387315, AA473386, B-raf, Braf-2, Braf2, C230098H17, C87398, D6Ertd631e
Definition
(RefSeq) Braf transforming gene
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04068  FoxO signaling pathway
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05034  Alcoholism
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109880 (Braf)
   04010 MAPK signaling pathway
    109880 (Braf)
   04012 ErbB signaling pathway
    109880 (Braf)
   04068 FoxO signaling pathway
    109880 (Braf)
   04024 cAMP signaling pathway
    109880 (Braf)
   04150 mTOR signaling pathway
    109880 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109880 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109880 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109880 (Braf)
   04062 Chemokine signaling pathway
    109880 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109880 (Braf)
   04914 Progesterone-mediated oocyte maturation
    109880 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    109880 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109880 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    109880 (Braf)
   04720 Long-term potentiation
    109880 (Braf)
   04730 Long-term depression
    109880 (Braf)
   04722 Neurotrophin signaling pathway
    109880 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109880 (Braf)
   05205 Proteoglycans in cancer
    109880 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109880 (Braf)
   05212 Pancreatic cancer
    109880 (Braf)
   05225 Hepatocellular carcinoma
    109880 (Braf)
   05226 Gastric cancer
    109880 (Braf)
   05214 Glioma
    109880 (Braf)
   05216 Thyroid cancer
    109880 (Braf)
   05221 Acute myeloid leukemia
    109880 (Braf)
   05220 Chronic myeloid leukemia
    109880 (Braf)
   05218 Melanoma
    109880 (Braf)
   05211 Renal cell carcinoma
    109880 (Braf)
   05219 Bladder cancer
    109880 (Braf)
   05215 Prostate cancer
    109880 (Braf)
   05213 Endometrial cancer
    109880 (Braf)
   05224 Breast cancer
    109880 (Braf)
   05223 Non-small cell lung cancer
    109880 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109880 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    109880 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109880 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109880 (Braf)
   05160 Hepatitis C
    109880 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109880 (Braf)
   01522 Endocrine resistance
    109880 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    109880 (Braf)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109880 (Braf)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109880 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 109880
NCBI-ProteinID: NP_647455
MGI: 88190
Ensembl: ENSMUSG00000002413
Vega: OTTMUSG00000035245
UniProt: P28028
Position
6 B1; 6 18.43 cM
AA seq 804 aa
MAALSGGGGSSSGGGGGGGGGGGGGDGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAI
PEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESL
VFQTPTDASRNNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCA
VYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLF
QGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVPQEEASFPETALPSGS
SSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPV
NIDEKFPEVELQDQRDLIRDQGFRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDF
EPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSSSEDRSRMKTLGR
RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVG
VLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQG
MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPE
VIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRS
NCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDF
SLYACASPKTPIQAGGYGEFAAFK
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggtggcagcagcagcggtggcggcggcggcggtggcggc
ggcggtggcggtggcgacggcggcggcggcgccgagcagggccaggctctgttcaatggc
gacatggagccggaggccggcgctggcgccgcggcctcttcggctgcggacccggccatt
cctgaagaggtatggaatatcaagcaaatgattaagttgacacaggaacatatagaggcc
ctattggacaaatttggtggagagcataacccaccatcaatatacctggaggcctatgaa
gagtacaccagcaagctagatgcccttcagcaaagagaacagcagcttttggaatccctg
gtttttcaaactcccacagatgcatcacggaacaaccccaagtcaccacagaaacctatc
gttagagtcttcctgcccaacaaacagaggacagtggtacccgcaagatgtggtgttaca
gttcgagacagtctaaagaaagcactgatgatgagaggtctcatcccagaatgctgtgct
gtttacagaattcaggatggagagaagaaaccaattggctgggacacggacatttcctgg
cttactggagaggagttacatgttgaagtactggagaatgtcccacttacaacacacaac
tttgtacggaaaacttttttcaccttagcattttgtgacttttgccgaaagctgcttttc
cagggtttccgttgtcaaacatgtggttataaatttcaccagcgttgtagtacagaggtt
ccactgatgtgtgtaaattatgaccaacttgatttgctgtttgtctccaagttctttgag
catcacccagtaccacaggaggaggcctccttcccagagactgcccttccatctggatcc
tcttccgcacccccctcagactctactgggccccaaatcctcaccagtccatctccttca
aaatccattccaattccacagcccttccgaccagcagatgaagatcatcgcaatcagttt
gggcaacgagaccggtcctcctcagctcccaatgttcatataaacacaattgagcctgtg
aatatcgatgaaaaattcccagaagtggaattacaggatcaaagggatttgattagagac
caggggtttcgtggtgatggagcccccttgaaccaactgatgcgctgtcttcggaaatac
caatcccggactcccagccccctcctccattctgtccccagtgaaatagtgtttgatttt
gagcctggcccagtgttcagagggtcaaccacaggcttgtccgccaccccgcctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggtcctcagcgggaa
aggaagtcatcttcttcctcatcctcggaggacagaagtcggatgaaaacacttggtaga
agagattcaagtgatgactgggagattcctgatggacagattacagtgggacagagaatt
ggatctgggtcatttggaactgtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcaacagctacaggccttcaaaaatgaagtagga
gtgctcaggaaaactcgacatgtgaatatcctccttttcatgggctattctacaaagcca
caactggcaattgttacacagtggtgtgagggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgctcggcagactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatattt
cttcatgaagacctcacggtaaaaataggtgactttggtctagccacagtgaaatctcgg
tggagtgggtcccatcagtttgaacagttgtctggatctattttgtggatggcaccagaa
gtaatcagaatgcaagataaaaacccgtatagctttcagtcagacgtgtatgcgtttggg
attgttctgtacgaactgatgaccggccagctaccttattcaaacatcaacaacagggat
cagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagacgag
agaccactctttccccaaattctcgcctccattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccttccttgaatcgggctggtttccaaacagaagatttt
agtctgtatgcttgtgcttctccgaaaacacccatccaagcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system