KEGG   Mus musculus (mouse): 109900
Entry
109900            CDS       T01002                                 

Gene name
Asl, 2510006M18Rik, ASAL
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00029  Urea cycle
mmu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109900 (Asl)
   00220 Arginine biosynthesis
    109900 (Asl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    109900 (Asl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     109900 (Asl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109900 (Asl)
SSDB
Motif
Pfam: Lyase_1 ASL_C2 T4SS_CagC
Other DBs
NCBI-GeneID: 109900
NCBI-ProteinID: NP_598529
MGI: 88084
Ensembl: ENSMUSG00000025533
Vega: OTTMUSG00000033763
UniProt: Q91YI0
Position
5 G1.3; 5 68.37 cM
AA seq 464 aa
MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEM
QQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTD
LRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENM
KQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLF
SGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRALLQAQEP
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcatcagagagcgggaagctatggggtggccggtttgtgggtgctgtcgaccccatc
atggagaagttcaactcatctatctcctatgaccggcatctgtggaatgtggatgtgcag
gggagcaaggcctacagcaggggcctggagaaggcggggcttctcaccaaagccgagatg
cagcagatactgcaagggttggacaaggttgctgaagagtgggcccaaggcaccttcaaa
ttacatcctaatgatgaagacatccacacagccaacgagcggcgcctgaaggaactcatc
ggtgaagctgcagggaagctacacacaggacgaagtcgcaacgaccaggtggtcacggac
ctcaggctgtggatgaggcagacctgctcaaaactctccgccctcctccgggtgctcatt
ggaaccatggtcgaccgggcagaggcggaacgtgatgtcctcttcccagggtacacacac
ttgcagagagctcagcccattcgctggagccactggatcctgagccacgctgttgcgctg
acacgagattcagagagactcttggaggtgcagaagcggatcaatgtcttgccactgggg
agtggggccattgcaggcaaccctctgggtgtggaccgggagctactccgtgcagaactg
aactttggggccatcactctcaacagcatggatgccaccagtgagagagactttgtggct
gagttcctgttttgggcttctctgtgtatgacccacctcagcaggatggcagaggaccta
attctctatggtaccaaggaattcagctttgtgcaactctcagatgcctacagcaccgga
agcagcttgatgccccagaagaaaaacccagacagcctggagctgatccggagcaaggcg
ggccgagtgtttggacggtgtgccggactcctgatgaccctcaagggacttccaagcacc
tacaacaaggacttacaggaagacaaggaggctgtgtttgaagtgtctgacaccatgata
gctgtcctccaagtggccactggagtcatctctacattgcagattcatcgtgagaacatg
aaacaggcgctcagccctgacatgctggccacggacctcgcctactacctggtccgcaaa
gggatgccattccgccaggcccacgaggcctcagggaaagctgtgttcatggcagagact
aaaggagtggctctcaacctgctgtcgctacaggagctgcagaccatcagtcccctgttc
tcaggtgatgtgagtcacgtgtgggactacagtcacagcgtggaacagtacagtgccttg
ggtggcacagcgaaatccagtgtcgaatggcagatcaggcaggtgcgggccctactgcaa
gcccaggagccctag

DBGET integrated database retrieval system