KEGG   Mus musculus (mouse): 109901
Entry
109901            CDS       T01002                                 

Gene name
Cela1, 1810009A17Rik, 1810062B19Rik, Ela-1, Ela1, PC-TsF
Definition
(RefSeq) chymotrypsin-like elastase family, member 1
  KO
K01326  pancreatic elastase I [EC:3.4.21.36]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    109901 (Cela1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.36  pancreatic elastase
     109901 (Cela1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109901 (Cela1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 109901
NCBI-ProteinID: NP_291090
MGI: 95314
Ensembl: ENSMUSG00000023031
UniProt: Q91X79
Position
15 F1; 15 56.38 cM
AA seq 266 aa
MLRFLVFASLVLCGHSTEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGGTL
IRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDI
ALLRLAKSVTLNNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVS
YSICSSSSYWGSSVKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSFVSSMGC
NVARKPTVFTRVSAYISWMNNVIASN
NT seq 801 nt   +upstreamnt  +downstreamnt
atgttgcgcttcctggtgtttgcttccctggtcctgtgtggacacagtaccgaggacgtt
ccggaaactgacgcccgcgtggttggaggggctgaagcccggaggaactcttggccgtct
cagatttccctccagtaccagtatggaggatcatggcaccacacctgtggaggcaccctc
atccgaagcaactgggtgatgaccgctgctcactgtgtggacagccccatgacttatcga
gtggttgtcggagagcacaacctgagccagaatgacggcaccgagcagtatgtgaacgtg
cagaagattgtgtcacacccctactggaacaagaacaacgtggttgcaggctatgacatc
gccctgctgcgcttggccaagagtgttacactcaataactatgtccagctgggtgttctg
ccccgggagggaaccatcctggctaacaactctccctgctacatcacaggctggggaaga
accagaaccaatggggagctggcccagaccctgcagcaggcatacctgcccagcgtgtcc
tatagcatctgctccagctcctcttactggggctcctctgtgaagaataccatggtgtgc
gctggtggagatggagtccgctctggatgccagggtgattctgggggacccctccactgc
atggtgaacggtcagtatgctgtccacggagtgaccagctttgtgtccagcatgggctgt
aatgtcgccaggaagcccaccgtcttcaccagagtctctgcttacatttcctggatgaat
aatgtcattgcctccaactga

DBGET integrated database retrieval system