KEGG   Mus musculus (house mouse): 110006
Entry
110006            CDS       T01002                                 
Symbol
Gusb, AI747421, Gur, Gus, Gus-r, Gus-s, Gus-t, Gus-u, Gut, asd, g
Name
(RefSeq) glucuronidase, beta
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00531  Glycosaminoglycan degradation
mmu00860  Porphyrin metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
mmu04142  Lysosome
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00076  Dermatan sulfate degradation
mmu_M00077  Chondroitin sulfate degradation
mmu_M00078  Heparan sulfate degradation
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110006 (Gusb)
   00053 Ascorbate and aldarate metabolism
    110006 (Gusb)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110006 (Gusb)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    110006 (Gusb)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110006 (Gusb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110006 (Gusb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     110006 (Gusb)
SSDB
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Other DBs
NCBI-GeneID: 110006
NCBI-ProteinID: NP_034498
MGI: 95872
Ensembl: ENSMUSG00000025534
UniProt: P12265
Position
5:complement(130011278..130031890)
AA seq 648 aa
MSLKWSACWVALGQLLCSCALALKGGMLFPKESPSRELKALDGLWHFRADLSNNRLQGFE
QQWYRQPLRESGPVLDMPVPSSFNDITQEAALRDFIGWVWYEREAILPRRWTQDTDMRVV
LRINSAHYYAVVWVNGIHVVEHEGGHLPFEADISKLVQSGPLTTCRITIAINNTLTPHTL
PPGTIVYKTDTSMYPKGYFVQDTSFDFFNYAGLHRSVVLYTTPTTYIDDITVITNVEQDI
GLVTYWISVQGSEHFQLEVQLLDEGGKVVAHGTGNQGQLQVPSANLWWPYLMHEHPAYMY
SLEVKVTTTESVTDYYTLPIGIRTVAVTKSKFLINGKPFYFQGVNKHEDSDIRGKGFDWP
LLVKDFNLLRWLGANSFRTSHYPYSEEVLQLCDRYGIVVIDECPGVGIVLPQSFGNESLR
HHLEVMEELVRRDKNHPAVVMWSVANEPSSALKPAAYYFKTLITHTKALDLTRPVTFVSN
AKYDADLGAPYVDVICVNSYFSWYHDYGHLEVIQPQLNSQFENWYKTHQKPIIQSEYGAD
AIPGIHEDPPRMFSEEYQKAVLENYHSVLDQKRKEYVVGELIWNFADFMTNQSPLRVIGN
KKGIFTRQRQPKTSAFILRERYWRIANETGGHGSGPRTQCFGSRPFTF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtccctaaaatggagtgcgtgttgggtcgcgctgggccagctgctgtgcagctgcgcg
ctggctctgaagggcgggatgctgttcccgaaggagagcccgtcgcgggagctcaaggcg
ctggacggactgtggcacttccgcgccgacctctcgaacaaccggctgcagggtttcgag
cagcaatggtaccggcagccgctacgggagtcgggcccagtcttggacatgcctgtccct
tctagcttcaatgacatcacccaagaagcagcccttcgggactttattggctgggtgtgg
tatgaacgggaagcaatcctgccacggcgatggacccaagataccgacatgagagtggtg
ttgaggatcaacagtgcccattattatgcagttgtgtgggtgaatgggattcatgtggtg
gaacatgagggaggtcacctcccctttgaggctgacattagcaagctggtccagagtggg
cccctgaccacctgccggatcacgattgccatcaacaacacactgacccctcataccctt
ccgccggggaccatcgtctacaagactgacacctccatgtatcccaagggttactttgtc
caggacacaagctttgacttcttcaactatgcgggactgcatcgatctgtggtcctctat
accacccctaccacttacatcgatgatatcactgtgatcactaatgtggagcaagacatc
gggctggtgacctactggatttctgtgcagggcagtgaacatttccagctagaagtgcaa
cttttggatgagggtggcaaagtcgtggcccatgggacagggaaccagggtcaacttcag
gttcccagtgccaacctctggtggccttacctgatgcatgagcatccagcctacatgtac
tccttggaggtgaaggtgacaacaactgagtctgtgactgactactacacccttcctatc
gggattcgaacagtggctgtcacaaagagcaagttcctcataaacgggaagcccttctat
ttccaaggggtcaataagcacgaggattcagatatccgagggaaaggcttcgactggccg
ctgctggtaaaggatttcaacctgctccgttggctcggggcaaattcctttcgtaccagc
cactatccctactcagaggaggtacttcagctctgtgaccgatacgggattgtggtcatc
gatgagtgtcccggtgtgggcattgtgctacctcagagttttggcaacgagtcacttcgg
caccacctagaggtgatggaggagctggttcgccgggacaaaaatcaccctgcggttgtg
atgtggtctgtggccaatgagccttcctctgctctgaaacccgccgcatattactttaag
acgctgatcacccacaccaaagccctggacctcacccgtcccgtgacctttgtgagcaac
gccaaatatgatgcagacctgggggccccgtacgtggatgttatctgtgtaaacagctac
ttttcttggtatcatgactatgggcatttggaggtgattcagccacagctgaatagccag
tttgagaactggtataagacgcatcagaagccgattatccagagcgagtatggagcagac
gcaatcccagggatccacgaggacccgcctcgcatgttcagtgaggagtaccagaaggct
gttctggagaattaccattcagttctggatcagaaacgtaaagaatacgtggtcggagag
ctcatctggaatttcgccgacttcatgacgaaccagtcaccgctgagagtaatcggaaac
aagaaggggatcttcactcgccagagacagcccaaaacttcggcctttattttgcgagag
agatactggaggattgccaacgaaaccggaggtcacggttcagggccgagaacccagtgt
ttcggaagcagaccgttcacgttctaa

DBGET integrated database retrieval system