KEGG   Mus musculus (mouse): 110033
Entry
110033            CDS       T01002                                 

Gene name
Kif22, AU021460, C81217, Ki, Kid, Kif2, Kif22a
Definition
(RefSeq) kinesin family member 22
  KO
K10403  kinesin family member 22
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110033 (Kif22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    110033 (Kif22)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110033 (Kif22)
SSDB
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6
Other DBs
NCBI-GeneID: 110033
NCBI-ProteinID: NP_663563
MGI: 109233
Ensembl: ENSMUSG00000030677
Vega: OTTMUSG00000058381
UniProt: Q3V300
Position
7 F3; 7 69.29 cM
AA seq 660 aa
MSLRAKTCPQRREMASATSGPGRCVSKGGLGRRPPLARVRVAVRLRPFMDGETEAKELPC
VRAIDSCSLEVANWKKYQETLKYQFDAFYGEKSTQQEVYVGSVQPILRHLLEGQNASVLA
YGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLAREESAEGRPWDVSVAMSYLEIYQEKVL
DLLDPASGDLVIREDCRGNILIPGLTQKPITSFSDFEQHFLPASRNRAVGATRLNQRSSR
SHAVLLVKVDQRERLTPFRQREGKLYLIDLAGSEDNRRTGNQGIRLKESGAINTSLFVLG
KVVDALNQGLPRIPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYQDTISALNFTARS
KEVINRPFTNESLQPHALAPVKLSQKELLGPSEAKKAKGPEEESTGSPESTAAPASASQK
LSLLQKLSNMDPAMLENLLSMERLLGSQGSQGTPLLNTPKRERMVLMKTVEEKNLEIERL
KMKQKELEAKVLAQEAPDPREKENTPTILQPPASYSGTVAKPLKKAVVMPLQRIQKQRES
SNQIQLLKKGPKRKLEPSPESEAVEKDEDYWEVQISPELLAHGRKKLLDLLNEGSARELR
SLQRIGQKKAQLIVGWRELHGPFSEVEDLEQVEGISGKQVESFLKANLLSLAASQHSGPS
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgagcttaagggctaagacgtgtccgcagcgacgggagatggcgtcggccacctcagga
cctggccgctgtgtaagcaaaggagggcttggccggcgtccgcctctagctcgagtaagg
gtggctgtgcggctgcgcccgtttatggatggagagacagaagcgaaggagctcccctgt
gtccgagccatagacagctgctctcttgaagtggctaactggaagaaataccaggagacg
ctcaaatatcagtttgatgccttctatggcgagaagagcactcagcaggaagtctatgta
ggttcagtacagcccatcctaaggcacttgctggaagggcagaatgccagtgtacttgcc
tatgggcctactggggcagggaagacacacacaatgctgggcagcccagagcaacctgga
gtgattcctcgggctctcatggacctcctgcaactagcaagggaagagagtgctgaggga
cggccatgggacgtttctgttgctatgtcctatttagagatctaccaggaaaaggtatta
gacctcttggatcctgcatcaggagacctcgtgatccgcgaagactgccgagggaacatc
ctgatcccaggcctcacacagaagcccatcaccagcttctctgacttcgagcagcacttc
cttccagccagtagaaatcgagctgtaggagccacccggcttaaccagcgctcttcccgt
agtcacgcagtgctcttggtcaaggtagatcagcgtgaacgtttgactccatttcgccag
cgggaaggaaaactctaccttattgatttggctggttcagaggacaaccgtcgcacaggc
aaccagggcattcggctcaaagagagcggagccatcaacacctccctctttgtactgggc
aaagtggtggatgcattaaaccagggcctccctcgcataccataccgggacagcaagctc
actcgtctgctgcaggactctctgggaggctcagctcatagcatcctcattgccaacatt
gctcctgaaagacgtttttaccaggatacaatttcagcattgaacttcactgctaggtcc
aaggaggtgattaaccggcctttcaccaatgagagtctacagcctcatgccttggcacct
gttaagctgtctcagaaagaactgctaggcccgtcagaggcaaagaaggccaaaggccct
gaagaagaatcaactgggagccctgagtctacagcagctccagcgtctgcctcccagaaa
ctaagcctcttacagaagctaagcaatatggatccagccatgttggagaacctcctgagt
atggaacgtttgctgggttcccagggaagccaagggacccccctactgaataccccaaag
cgagaacgaatggtgctcatgaagacagtggaggaaaagaacttagagattgagaggctt
aagatgaagcaaaaagaactggaagccaaggtgttggcccaggaggcaccggatccaagg
gaaaaagagaacactcccacaattctccagccgcctgcctcttatagtggcacagtggca
aagcccctgaaaaaggctgtagtgatgcccctgcaacggattcagaagcagcgagagtcc
tcaaaccaaatccagctcctgaagaaaggccccaaaaggaagctggagccatcccctgag
tcagaagctgtggaaaaggatgaggactactgggaggtacagattagcccagagttactg
gcacatgggcgcaaaaaattattggatctgctgaatgaaggctcagctcgggaactgcgc
agcctgcagcgcattggccagaagaaagcccagctcatcgtgggctggagggagctccac
ggccccttcagtgaggtggaggacttggaacaggtggaaggcatctctgggaagcaggtg
gagtctttcctgaaggcgaatctcttgagcttggccgccagccagcacagcggtccctct
tga

DBGET integrated database retrieval system