KEGG   Mus musculus (mouse): 110058
Entry
110058            CDS       T01002                                 

Symbol
Syt17, Bk, sytXVII
Name
(RefSeq) synaptotagmin XVII
  KO
K19915  synaptotagmin-17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    110058 (Syt17)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    110058 (Syt17)
SSDB
Motif
Pfam: C2
Other DBs
NCBI-GeneID: 110058
NCBI-ProteinID: NP_619590
MGI: 104966
Ensembl: ENSMUSG00000058420
Vega: OTTMUSG00000057261
UniProt: Q920M7
Position
7 F1; 7 63.44 cM
AA seq 470 aa
MLEPLNEGLLSRISDVLLCGWTCQHCCQRCYESSCCQSSEDEVEILGPFPAQTPPWLMAS
RSNDKDGDSVHTASDVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLDSRRPSSPLIDI
KPVEFGVLSAKKESIQPSVLRRTYTPDDYFRKFEPRLYSLDSNLDDVDSLTDEEIMSKYQ
LGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQ
TGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVAVPLCEVDLVK
GGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDIIRAKQLLQTDVSQGSDPFVKIQ
LVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGR
IVIGQYSSGPSESNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgttggaaccactgaacgagggcttgctttctagaatctctgacgtgctgctgtgcggc
tggacttgccaacactgctgtcagaggtgctatgagtccagctgctgccagtccagtgaa
gatgaagtggagatcttggggcctttccctgcccagactcctccatggctgatggccagc
cggagcaatgacaaggatggagactccgtgcatacagccagcgatgttcctttgacccca
aggaccaactcccctgatgggagacgctcgtcctcagacacatccaagtccacgtacagc
ctgactcggagaatctccagtctggattcccggcgccccagctccccactcatcgacatc
aaacccgttgagttcggcgttctcagtgccaagaaggagtccatccagccgtctgtgctg
cgccggacctacacgcccgatgactacttccggaagtttgagccccgactttactccctc
gactccaatcttgatgacgtagactctctgactgacgaggagatcatgtccaagtaccag
ctgggcatgctgcacttcagcacacagtatgacctgctacacaaccacctcaccgtgagg
gtgatcgaggcccgggacctgccacctccaatctcccatgatggctcgcgccaggacatg
gcccactccaacccctacgtcaagatctgcctcctgcctgaccagaagaactccaagcag
acgggagtcaaacgcaagacccagaagcctgtgtttgaggaacgctacaccttcgagatc
cccttcctagaagcccagaggaggaccctgctgctcactgtggtggattttgacaaattc
tcccgccactgtgtgattgggaaagtagcggtgcctttgtgcgaggtggacttggtgaag
ggtggccactggtggaaggccctgatccccagttctcagaatgaagtggagctcggggag
ctgctgctttctctaaattatctcccaagtgctggcagactgaacgtggacatcattcga
gccaagcaactcctgcagaccgatgtgagccagggttcagacccatttgtgaaaatccag
ctggtacacggactcaagcttgtgaaaactaagaagacatcattcttacgaggcacaatt
gatcctttttacaatgaatccttcagcttcaaagttccccaggaagaactggaaaacgcc
agcctagtattcacagtgttcggccacaacatgaaaagcagcaatgacttcatcgggagg
atcgtcatcggccagtattcctccggcccctcagaatccaaccactggcggcggatgctc
aacactcaccgcactgctgtggaacaatggcatagcctgaggtcccgggctgagtgtgac
cgcgtgtctcctgcctccctggaggtgacctga

DBGET integrated database retrieval system