KEGG   Mus musculus (mouse): 110078
Entry
110078            CDS       T01002                                 

Gene name
Pygb
Definition
(RefSeq) brain glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04217  Necroptosis
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
Module
mmu_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110078 (Pygb)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110078 (Pygb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110078 (Pygb)
   04922 Glucagon signaling pathway
    110078 (Pygb)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110078 (Pygb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     110078 (Pygb)
SSDB
Motif
Pfam: Phosphorylase TPR_22
Other DBs
NCBI-GeneID: 110078
NCBI-ProteinID: NP_722476
MGI: 97828
Ensembl: ENSMUSG00000033059
Vega: OTTMUSG00000015772
UniProt: Q8CI94
Position
2 G3; 2 74.74 cM
AA seq 843 aa
MAKPLTDSERQKQISVRGIAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQTACDEATYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVLWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLKDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSRFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDLSQLKKLLSLVDDEAFIRDVAKVKQ
ENKLKFSAQLEKEYKVKINPASMFDVHVKRIHEYKRQLLNCLHIITLYNRIKKDPAKAFV
PRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVE
ALDQKGYNAREFYERLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMYHDRFKVFADYEA
YIQCQAQVDRLYRNSKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNL
PKD
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcgaagccgttgacggacagtgagaggcagaagcagatcagcgtgcgtggcatcgcg
gggctgggcgacgtggccgaggtgcggaagagcttcaacagacacctgcatttcacgctg
gtcaaggaccgcaatgtggccacgccccgcgactacttcttcgctctggcacacacagtt
cgcgaccacctagtgggccgctggatccgcacgcagcagcattactatgagcgggacccc
aagcgcatctattacctttccctggaattctacatgggccgcacgctgcagaataccatg
gtgaacctgggccttcagactgcatgcgacgaagccacttatcagttggggttggacttg
gaagagctagaggagatagaggaggatgctggtcttgggaatggcggcctggggcgcctg
gcagcctgcttccttgattcaatggccaccctgggtctggctgcatacggctatggaatc
cgatatgaatttgggattttcaaccaaaagattgtcaatggctggcaggttgaagaagct
gatgactggctacgctatggaaacccctgggagaaggcacggccggagtacatgctgccg
gtgcatttctacgggagggtggagcacacccctgacggggtcctctggctggacacgcag
gtggtactcgctatgccctacgacaccccagtgcctgggtataagaacaacacagtcaac
accatgaggctctggtctgccaaggcacccaatgacttcaagctgaaggacttcaacgtt
ggggactacatcgaagctgtcctggataggaacttggctgagaacatctccagggtcctg
tatcccaatgacaatttcttcgaggggaaggagctgcggctgaagcaggagtactttgtg
gtggctgccaccctccaggacatcattcgaaggttcaagtcttccaggtttggctgccgg
gacccagtgagaacctgtttcgagacattcccagacaaggtagccatccagctgaatgac
acccaccccgcgctctccatccctgagctcatgcggatcctggtggacgtggagaaggtg
gactgggataaggcctgggagatcaccaagaagacctgtgcctacaccaaccacacggtg
ctgcccgaggccctggagcgctggccagtgtctatgtttgagaagctgcttccgcggcac
ctggaaataatctatgccatcaaccagaggcacttggaccacgtggctgccctgtttcct
ggggacgtggaccgactgaggaggatgtccgtgattgaggaaggggactgcaagagaatc
aacatggcacacctgtgtgtgattgggtcccacgctgtgaacggggtggcaaggattcac
tctgagatcgtgaagcagtctgtctttaaggacttttacgaactggagccagagaagttc
cagaacaagacaaatggcatcacgccccgacggtggctgctgttgtgtaacccggggctg
gcagaaatcattgtagagagaatcggggaaggtttcctgaccgatctgagccaactgaag
aagctgctgtcactggttgatgatgaggccttcatcagagacgtagccaaggttaagcag
gaaaacaagctgaagttctctgcccagctagagaaggagtacaaggtgaagatcaaccct
gcatccatgtttgatgtgcacgtgaagaggatccacgaatataagcgacagctgctcaac
tgcctacacattatcaccctgtacaaccgaataaagaaggatccagccaaggcctttgtg
cccaggactgttatgattgggggcaaggcagctcctggttaccacatggctaagatgatc
atcaagctggtcacatccattggagatgttgtcaatcatgatccagttgtgggcgacagg
ctcagagtgatcttcctggagaactaccgtgtgtctttagctgagaaagtgatcccagcg
gctgacctgtcccagcagatctccactgcgggcactgaagcctcgggcacaggcaacatg
aagttcatgctcaatggagcgctcaccatcggcaccatggatggtgccaacgtggagatg
gccgaggaggccggggaggagaacctcttcatctttggtatgcgggtggaagatgtcgag
gccctggaccagaaagggtacaatgccagagaattctatgagcgcctgcctgagctgagg
caggctgtggatcagatcagcagtggcttcttttctcccaaagatccagactgcttcaag
gacgtggttaacatgctgatgtaccacgacagattcaaggtatttgcagactatgaagcc
tacatccaatgccaggcccaggtggaccgtctataccggaattccaaggagtggactaaa
aaggtgatcaggaatatagcctgctctggcaagttctccagtgaccggaccatcactgaa
tacgcccgggagatctggggtgtggagccctctgacctgcagatcccaccccccaacctc
cccaaggactaa

DBGET integrated database retrieval system