KEGG   Mus musculus (house mouse): 110082
Entry
110082            CDS       T01002                                 
Symbol
Dnah5, Dnahc5, Mdnah5, b2b1134Clo, b2b1154Clo, b2b1537Clo, b2b1565Clo, b2b3491Clo, b2b601Clo, mKIAA1603
Name
(RefSeq) dynein, axonemal, heavy chain 5
  KO
K10408  dynein axonemal heavy chain
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110082 (Dnah5)
   05016 Huntington disease
    110082 (Dnah5)
   05022 Pathways of neurodegeneration - multiple diseases
    110082 (Dnah5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    110082 (Dnah5)
   04812 Cytoskeleton proteins [BR:mmu04812]
    110082 (Dnah5)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein arm
   110082 (Dnah5)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     110082 (Dnah5)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 AAA_lid_1 Dynein_AAA_lid FtsK_SpoIIIE AAA_33
Other DBs
NCBI-GeneID: 110082
NCBI-ProteinID: NP_579943
MGI: 107718
Ensembl: ENSMUSG00000022262
UniProt: Q8VHE6
Position
15:28155000..28472191
AA seq 4621 aa
MFRIGRRQLWKQSVTRVLTQRLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALL
EGNQIERMDQLFAVGGLRHLMFYYQDVEGAEAGHCGSSGGVNPASGKMKKPKVFVTEGKD
VALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASS
HGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDY
LALASNPETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYL
LDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYS
SDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATI
WSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRL
AKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEF
CKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDI
DTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQHPFVLRTAEAKPVI
RSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRE
TQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLAR
VDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMAL
CQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAEN
VCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFN
HQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQNHLPIFRASVTLAIPNIAM
TPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEE
NELQETLEIASINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKR
YNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLK
LSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEI
REQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGAL
QPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYI
TYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKIN
NELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALT
GHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFS
GFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIE
NWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDE
TMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLL
NVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLV
IRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAF
LELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFY
FKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAG
TGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLS
VAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRS
VAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLR
TLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELE
TAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCG
KPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDA
IWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVL
DWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQ
GLIPPKEQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTD
AGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQG
KAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTT
YGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFL
AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDAL
IKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWK
HECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATG
ETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISR
VIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAG
QQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRR
PPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALV
AVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQ
GYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLK
EVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKP
SDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFL
QNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEV
LPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCR
HKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLL
HDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLL
IDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNV
LEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGL
EDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLII
VLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTS
LRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKI
DIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQIS
RNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGEN
YAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHA
RKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLL
QMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGP
LGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRL
LNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADIT
YQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKM
GPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPAR
WKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRAN
KGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFEL
MPVIRIFAENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDV
K
NT seq 13866 nt   +upstreamnt  +downstreamnt
atgtttaggatcggcagacgacaactctggaagcagagtgtcacccgagttctgacgcaa
cgactgaaagaagagaaggaagccaagagggcccgtctggatgggcggcatgactatctg
tttgcaattgtagcttcctgtttggacctgaacaaaccagaagtggaagatgctcttctt
gagggtaatcagattgaaagaatggatcagctttttgctgttggtggactccgtcatctc
atgttttactatcaggatgtggagggagcagaagcagggcactgtggttcctcaggaggg
gtgaatcctgcctccggaaagatgaaaaagcccaaggtgttcgtgaccgaagggaaagac
gttgctcttatgggagcatgtgtgttcttcatcaggtctgacccatccaaagccattacg
cctgagaacatccaccgggaggtgagctttaacacgttagacacggcagatgggggcctg
ttgaacagcgtgaggcgtctgctctcagacatcttcatcccagctctcagggcctcaagc
catggctggggtgagctcgaggggctacaggatgcatccagcattcggcaggagttcctg
agctctctggaaggctttgtgggcatcttgtcaggtgcacagaacagtctgaaggagaag
gtgaaccttcaaaaatgtgacatcattgaactaaaatctctgaaggaacccacggactac
ttggctctagctagtaatcccgagactgtggaaaaagtagagtgctgcatgagagtgtgg
atcaaacagatggagcagatccttgctgagaacagtcagctacggaaggaagcggacgat
gtggggccccgagcagagctggagcactggaaacaaaggctctccagatttaattacctc
ttagatcagctgaaaagccccgacgtgaaggctgcgctggcattgcttgctgcggccaag
tccaagcttctgaaggtttggagagatacagacattaggatcactgacgcagccaatgaa
gcaaaagacaatgtcaagtatttgtacacactggagaaatgttgtgaccctctgtacagc
agtgaccctgtaactatgatagatgcgattcctacacttataaatgcaattaagatggtt
tacagcatctctcactactataacacctctgagaagatcacatctctgtttgtaaaggtg
acaaatcagatgatatctgcatgtaaagcccatatcaccaacaatgggactgccaccatc
tggagccagcctcaggagattgttatgcaaaaaatagcagctgtgattaagctcaagcag
ggataccaatcctgctttcaggagacaaaacaaaagcttaagcaaaatccaagcgaaaaa
caatttgactttagtgagatgtatatttttggaaaatttgaaactttccaccgacgtctg
gccaagataatggacatcttcactaccttcaagacatactcagtcctgcaagattccaaa
atagaggggttggaagacatggcgactaagtaccaggacattgttgctgccataaagaag
aaagagtataacttcttagatcaacgggaaatggattttgaccaagattatgaagagttt
tgcaagcggattaatgagcttcataatgacctgcagaggttcatggacatcacatttgaa
aagattccaagcacgaggcaagctctaagcacgctgaagaaattcgaaagactgaatata
cctaatcttggtattgaggaaaaataccaaataattttccagaattttgcgactgacatc
gacacgatttctaagctgtatacgaaacagaagtacgatccgcccttggctcgcaaccag
ccccccatagctgggaagatcttgtgggcccggcagctattccacaggctggagcagcca
atgcaactcttccagcagcatccctttgtgctgaggactgcggaggccaaacctgtgatc
cgcagctataacaggatagccaaggtcctcttggagtttgaggtcctctaccacagggcc
tggcttcagcagattgaagaaattcatgcaggtcttgaggcttccttattggtgaaggct
ccaggcacaggggagttgtttgtgaactttgatcctcagatattagtcttatttagagaa
acacaatgcatgtctcagttgggtctacctgtgtcaccgtttgcagctgccctcttccag
aagcgggacatgttcaaaaagaatttcagtgacatgaagatgatgctgtctgaatacgag
agagtgaagttgaaaatgcctcctgccatcgagcagttgatgtttccacacctggctaga
gtggatgaagccctccagccgggcctggctgtcctgacttggacgtccctgaatattggg
ggctatttagaaaatgcctttgcaaagatcaaggacctggagctgctgcttgaccgggtc
aatgacttgattgagttccgcatccacgccatcctggaggaaatgagtagcatggctctt
tgtcagctccctcaggatgaccccctgacttgtgaagaattcctccaaatgacaaaggat
ctctgtgtgagtggtgcgcagctactccattttaaaagctcccttgtggaggaagcagtc
aatgagctaataaacatgttattggatgtggatgtaccacctgaagaagcagccgaaaac
gtctgccatgagaacgccagtcctagcggtaacacttcaggaagaagagaagggcattct
gaggccttggcatcttccttcaatgccggggccagctctctgccattgacagcaactgca
agaaagaagaaagaaaccgaggtgttagaggaagcccgtgagctgctctcccactttaac
caccagaacacagatgctcttttgaaagtgaccaggaatacacttgaggccattcgcaga
cgcattcacttctcccacatgattaacttccgggacagtaatgatgcgtctaaggcaaag
cagaaccatctgcccattttccgggcaagtgtcactctggccattcccaacatcgctatg
actcctgccctggaagacatacagcagacgctgaacaaagccgtggaatgcatcatcagt
gtccccaagggggttagacagtggagcagcgagctgttgtccaagagaaagatgcatgaa
agaaaaatggctgccgtgaagaacaacgaagacagtgattcagacgctgaggtggaggaa
aatgagctgcaagaaactctggagatagcatccataaacttacccatcccagtgcaaacc
cagaattactataagaatatttctgacaacaaagagattgtaaagttggtatctgtgctc
agcacagtcatcagctccaccaagaaggaagttatcacatccatggaccgcttcaaacgc
tacaatcacatttggcagaaggagaaagaagacaccatcatgacctttattgcacaaaac
cctttgcttcctgagtttgagtccaggattctttattttcaaagcctggagcaggaaatt
aatgcagagcctgaatacatccgtgtgggttccattgctctatatacagctgatttgaag
ctttcactgaccgcagagacgaaagcctggatggcggtcataggccgtcactgcaacagg
aagtacagggctgagatggaaaacattctcacagttgtcgaagaatcccagaagaaactg
agccggccgatcaaggacctggatgatattaggatagcaatggcggccctgaaggagata
agggagcagcagatctccaccgacttccaagtgggacctattgaggaatcctatgccctc
cttaacaagtatggacttctggtagccaaggaagagatggacaaagtggacactttgcgc
tatgcttgggagaagctgctggcccgggccagtgatgttcagaatgagttaggcgctctg
cagcccagtttccggaaagagctcatcagcacagtggaggtgttcctccaagactgccag
cagttttacctggactatgatttgaatggtccgatggcaagtggattgaagccccaggaa
gccagcggcaggcttattatattccagaatcaattcgataacatatatcgtaaatacatc
acctacactggaggagaggaactttttggtttgccagttacaccgtatcctcagcttctt
gagataaagaggcagctgaatcttctacagaaaatatacagcctgtacaacaatgtcatc
gagactgtgaatagttatcaagataccctttggtcagacgtgaacattgaaaaaatcaac
aatgaactcttagaattccaaaacaggtgtcggaagctgcctcgggccctgaaggattgg
caggcctttctggatctgaagaagaccattgatgacttcagtgagtgctgtccattgctg
gagtacatggccagtaacgccatggtggaacgacactggcagaggatcactgctctcact
gggcacagtctggatgtgggcaatgagacctttaagttacgaaatatcatggaagctcct
ctgctaaaatacaaagaggaaattgaggacatttgcatcagtgccgtgaaggagagagac
attgagcaaaagctgaggcaagtgatcaatgagtgggacaacaaaacattaacatttagt
ggctttaagacccgtggagaactcctcctgagaggagacagtacctccgaagtcatcgcc
agcatggaggatagcttgatgctgctgggctctctccttagcaacaggtacaatatgcca
ttcaaagcccagattcaaaaatgggtgcagtgcctttccaactcaacagacatcattgag
aactggatgaccgttcaaaacttgtggatttatctagaagctgtcttcgtgggaggagac
attgccaagcagctgcccaaggaagccaagcgcttttccaatatagataagtcttgggtg
aagatcatgacacgggcacatgagataccaaatgtggttcagtgttgtgttggagatgag
accatggggcagctactgccacacttactggaccagttggaaatctgccagaagtcgctc
acaggatacttggagaagaaaaggctgtgttttcctcgcttctttttcgtctcagatccc
gctctgctggagattctgggccaggcatcggactcccacaccatccaggcccatttgctg
aacgtgtttgacaacattaaaactgtcaagttccatgacaagatctatgatcggattctg
tcaatctcctctcgggagggcgagacaattgaattggacaagcctgtgatggcagagggc
aatgtggaagtctggcttaattctctgctggaggagtcacagtcctcattacatcttgtg
attcgccaggcagctgcaaatattcaagaacccggtttccaattgattgaatttctttct
tccttccccgctcaggttggattattaggaattcagatgctatggacccgggactcagaa
gaagcccttcgaaatgccaagtttgataagaaaatcatgcagaagaccaatcaggccttc
ctagagctactgaacatgctgatcgagattaccacgaaggacctgagctccatggaacgg
gttaaatacgagactctgattactatccatgtgcaccaaagggacatctttgatgacctg
tgtcacatgcacgtcaagagccctacggactttgaatggctgaaacagtgcaggttctat
tttaaggaggattctgacaagacgatgatccacatcaccgacgtggctttcatataccag
aatgagtttttaggctgcactgacagacttgtcataacaccgctcacggacaggtgctat
atcacattggctcaagctctgggcatgagcatgggaggagcccctgctggtcccgcaggg
acaggcaagacagagaccaccaaggacatgggccgatgtcttgggaaatatgttgtagtt
ttcaactgctcggaccagatggatttccgaggacttgggcggatattcaaaggactggca
cagtctgggtcctggggttgctttgatgaattcaaccgtatcgatctaccagttctgtca
gttgcagcccagcaaatctccattattctcacgtgtaaaaaggagcataaaaaatctttc
atttttactgatggagataatgtgaccatgaacccagaatttggactttttctaaccatg
aaccctggctatgctggacgccaggagctcccggagaacttgaagatcaacttccgctct
gtggctatgatggtccctgaccggcagattatcatcagggtgaagctggccagctgcggc
ttcattgataacgtagttctggccagaaaatttttcacgctctaccagctgtgtgaggag
cagctctcgaagcaggttcactatgactttggtctccgcaacattctgtcagttctgcgc
accctgggagcagcaaaaagagccagtcccacggatacagaatccaccatcgtcatgcgc
gtgctgcgggacatgaatctttccaaactgattgatgaagatgagcccctgtttttgagt
ttgattgaagatctatttccaaatattcttttggacaaggcaggctatcctgagctggag
acagcaatcagtaaacaggttgaggaagctggcttaattaaccaccctccttggaaactg
aaagtcatccagttgtttgaaacgcagagggtgaggcacggcatgatgaccctggggcct
agtgggtcagggaagaccacctgcatccacaccctgatgaaagccatgacagattgtgga
aagcctcacagagaaatgaggatgaatcccaaagcaatcacagccccacagatgtttggt
cgactcgatgtggccacaaacgactggactgatggaatattttctaccctttggaggaag
acactgaaagcaaagaaaggggaacatatctggattgttcttgatggtccagttgatgcc
atctggattgaaaatctgaattctgtgctggatgataataaaaccctgactctggccaat
ggcgaccggatccccatggctccaaactgcaagattgtttttgaacctcataacattgac
aatgcttctcccgccaccgtctcaagaaatgggatggttttcatgagttcctcagtcctc
gactggagtcctattcttgagggttttctcaagagacggtctcctcaagaggctgaaatc
cttcgacagctgtatgcagagactttcccggacctgtatcggttcagcatccagaacctg
gagttcaagatggaggtactggaagcctttgtgatcacacagagcacccacatgctgcaa
ggcctgatccccccaaaggagcaggccggggaggtggacccggagcatctggggaggctg
tttgtctttgccatgatgtggagtgtgggcgcagtcctggagttggaaggtcgccggagg
atggaactctggctgcgctctcgagaagggcccacactgcacctgccacagctgacggac
gctggggacaccatgttcgactactatgtcgcgccaaacggtacttggaggcattggagc
ctgtgtaccccagaatatgtgtacccacctgacaccaccccagaatatggatctatcctt
gtgccaaatgtggacaatgtgcggaccgacttcctaattaaaaccattgccaaacaaggc
aaggctgtgctgttaattggtgagcaagggacagccaaaacagtcatcatcaaaggattt
atgtcaaaatttgaccctgaaagtcacatggtgaagaatctgaacttttcttcggcgacc
accccagtgatgtttcagaggacaatagagagctacgtggataaacgcatgggcacgaca
tatggtcctcctgcggggaagaaaatggctgtctttattgatgatttaaatatgcctgta
atcaacgaatggggtgatcaggttactaatgagattgtccgacagctgatggaacaaagt
gggttctataacctggagaagcctggagagttcactagcattgtggacatccagttcttg
gcagccatgatccatcctgggggtggacgcaatgacataccacagcgcttgaagagacag
ttctccatattcaactgtaccttgccttcagatgcttccatggacaagatctttggtgtg
attggggcaggctactactgtgcccagcggggcttctcggaggaagttcaagatgctctg
ataaagctggtacccctgacgcgccgtctgtggcagatgaccaaactgaagatgctccca
acgcctgcgaaattccactatgtgttcaaccttcgagacctctccaggatctggcagggc
atgctgaacatcacttcagaggtcatcaaagacacagacgaactcctcaggctgtggaag
catgagtgtaaacgtgtgatagctgaccgctttagcatgtccagcgatgtgacctggttc
gataaggctgttgtcagtttggtagaggaggagtttggtgaagagaaagcacctgtagtg
gattgtggagttgatgcttattttgtggatttcttgagggatgcaccagaagctacaggt
gaaacacctgaggaggctgatgctgaaatgccaaagctttatgagccaatcgcatccctt
aaccacctgcgagagcgtctgagtgtgttcctgcagctctataacgagagcatccgtggc
actggcatggacatggtgttcttcatagatgcaatggttcacttagtcaagatctctcga
gtcatacgcactcctcggggaaatgcccttctggttggtgtgggtggatcaggaaagcag
agcttgacaaggttggcttcattcatcgctggctatacctctttccagatcactctgaca
agatcctacaacacctcgaacctgatggaagatctgaaggtcttgtacaggactgctggc
cagcaaggcaaagggatcacttttattttcacagacaatgagattaaagaggagtcgttt
ctggagtacatgaacaatgtcctgtcatcgggcgaggtctccaacctctttgctcgggat
gaaattgatgaaatcaacagtgacctgacacccattatgaagaaggagcatcccaggcgc
ccgcccaccaatgacaacctgtacgagtatttcatgagcagggtccgaggaaacctgcac
attgtgctctgcttttctcccgtgggggagaaatttcgaaaccgagctttgaagttcccc
gcccttatttcaggatgcaccatcgactggttcagccgatggcccaaggatgctttagtt
gctgtgtcggaacacttcctctcatcctataccattgactgcacagcggagatcaagaag
gaattggtccagtgcatgggctcttttcaggatggggtagctgagaaatgcgccgattac
ttccagaggttccggcgctctacccacgtgacgcccaaatcctacctctcctttattcag
ggctataaattcatatatgaagaaaagcacatggaagtgcagagcctggccaacagaatg
aatactggattggaaaagctaaaagaagcgtcagaatcggtggcagccttgagcaaagaa
ctggcaggaaaagagaaggagctgcaggtggccaatgagaaagcagacacggttttaaag
gaagtcacaatgaaggcacaggctgcagagaaggtcaaagctgaggtgcagaaggtaaag
gacaaagcacaggccattgtcgacagcatctccaaggacaaagccatcgcagaagagaaa
ttagaggcagcaaagccagccctagaagaggcggaagccgcactccagaccatcaagccc
tctgacattgccacagtgcgcaccctgggcagaccccctcacctgatcatgcggatcatg
gactgtgtgctgctgctgtttcagaggagggtcaatgcggtgaaaattgacgtggacaaa
ggctgcaccatgccttcctggcaggagtctttgaaattgatgacagcaggaaactttctc
cagaacctacagcagttccccaaagacacgatcaatgaagaagtgatagaatttttgaat
ccttactttgaaatgtccgactacaacatcgagacggccaagcgcgtctgtgggaatgta
gccggactttgttcctggaccaaagctatggcttcctttttttctataaacaaggaggtg
ctccctctgaaggccaacttgatagtgcaagagaatcgtcacatcctggccatgcaggac
ctgcagaaagcccaggctgagctggatgccaagcaagcagagcttgatgtggtgcaggca
gagtatgaacaggccatggcagagaagcagaccttgcttgaagatgcggaccggtgtagg
cataagatgcagacagcatccacgctcatcagtggcttggcaggtgaaaaggagcgatgg
acggaacaaagtaaagagtttgctgcacaaactaaacggctcgtaggggatgtgctgctg
gctacggcttttctgtcatactctggtccatttaaccaagagtttcgagacctgctgcta
catgattggaagaaggaaatgaaagctcgtaaaatcccgtttgggaatggtctaaatctc
aacgagatgctgatcgatgcccctactatcagcgaatggaacctccaaggccttccaaat
gatgacctgtccatccagaatggaattattgtcacaaaagcatcacgctatcctttgctc
attgaccctcagactcaaggcaagatctggattaagaataaagagagccaaaatgaactc
cagatcacatctctaaaccacaagtactttagaaaccacctggaggacagcctttcactg
gggaggcctttgctcatcgaggatgttggagaggaattagaccctgctctagacaacgtt
ttggaaaaaaacttcattaaaacaggatctacttttaaggtgaaggttggagacaaggaa
gtggatgtcatggacggctttaaactttatatcactaccaaactgccgaatccagcctat
accccagaaataagtgctcggacctccatcatcgacttcactgtcaccgtgaagggcctg
gaggaccagctactggggagagtcattctcacggagaagcaggaactggagaaagaacga
actcatctcttggaggatgtaactgcaaacaaaagaaggatgaaggagctagaagataat
ttgctttaccgcctgacaagcactcaagggtctctggtggaagatgagagtctcatcatt
gtgctgagcaacaccaaaaagacagctgaggaggtgacacagaagctagaaatttctgga
gagacagaaattcaaattaactcagcccgggaggaataccgacctgttgctacacggggc
agcatcctctacttcctgatcacggagatgcgcttggttaatgagatgtatcagacttcg
ctccgtcagtttctgggcttgtttgacctttccttagccaggtctgtcaagagcccaatt
acaagcaagaggattgctaatatcattgagcacatgacctatgaggtattcaagtatgct
gcccgaggcctatatgaagagcataaattcctgttcactttgttgctcaccctaaagatt
gacatccagaggaacctagtcaaacatgaggagtttctcactctcattaaaggtggtgcc
tcattggatctaaaagcctgtcctcctaagccatcaaaatggatcctagacatgacttgg
ctgaatttggtggaacttagcaaacttaaacagttttcagacatccttgatcagatatca
aggaatgaaaagatgtggagagtttggtttgataaagaaaacccagaagaggagccgctt
ccaaatgcctacgataaatctctcgactgcttcagacgcctccttctgattaggtcctgg
tgtcccgacagaaccattgcccaggctcgcaagtacatcatggactccatgggagaaaac
tatgcagagggagttatcctggacttggaaaagacatgggaggaatctgacccacggaca
ccactcatctgcctcctgtccatgggctccgaccccacagattccatcattgctttggga
aagagactaaaaatagaaacacgctatgtgtccatgggccagggccaggaggtccatgcg
aggaagctgttgcaccagaccatggcaaatggaggatgggtacttctacagaactgccac
ctgggacttgacttcctggatgagctaatggacgtagttacagaaacggagactgtgcat
gacactttccgcctgtggatcaccaccgaggttcacaagcagttccccatcactctcctt
cagatgtccatcaagtttgccaatgagccacctcagggcctccgggcgggactgagaagg
acatatggtggtgtgagccaggacctactggatgtgagtgtgggggcccagtggaagccc
atgctatatgcggtggccttcctacactccactgtccaggagcggcgcaagttcggtcct
ctggggtggaatatcccttacgaatttaaccaagcagacttcaatgccacggtgcagttc
attcaaaatcacctagatgatatggatgtcaagaagggtgtatcctggaccactgtccgc
tacatgataggagagattcagtatggaggcagagtcactgatgactacgataagaggttg
ctgaacacatttgcaaaggtttggttcagtgaaaacatgtttggaccagatttcaccttt
taccaaggatacaacattccaaaatgcagtacagtggatggctatcttcagtacatccag
agcttgcctgcctatgacagcccagaggtgtttgggctccaccccaatgctgacattact
taccagagcaagctggccaaggatgtgctggacactatcctgggcatccagcccaaggac
agctccggtggaggggacgagacacgggaggctgtggtggcccgcctggctgatgatatg
ctagagaagcttccagaagattatagtccttttgaagtgaaggagagattgcagaagatg
ggaccattccagcccatgaacattttcctcaggcaggagattgacaggatgcagagggta
ctcagccttgtccgtagcaccctgactgagctgaaactagctgttgatggcaccattatc
atgagtgaaaatctaagagatgctctggattgcatgtttgatgccagaatccctgctcgg
tggaaaaaggcatcatgggtgtctagtaccctgggcttctggtttactgaacttctagaa
agaaactgccagttcacctcctgggtttccaatggcagaccccactgcttttggatgaca
ggtttctttaacccgcagggattcttaactgcgatgcgacaggaaataactcgagccaac
aaaggatgggctttggacaatatggttctttgcaatgaagtcaccaaatttatgaaggac
gacatttctgctcctcctacagaaggggtctacgtctatggcttatatcttgagggtgct
ggctgggacaaaaggaacatgaaactcattgaatccaaacccaaagtgctttttgagctg
atgcctgtcataaggatttttgcagaaaacaatactgcaagagatcctcggttgtactgc
tgccccatctacaagaagccagttcgaacagacttgaactacattgctgctgtggacctc
aagacagctcaggcccctgaacactgggttctccgtggggttgcccttctctgtgatgtc
aagtaa

DBGET integrated database retrieval system