KEGG   Mus musculus (mouse): 110095
Entry
110095            CDS       T01002                                 

Gene name
Pygl
Definition
(RefSeq) liver glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04217  Necroptosis
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
Module
mmu_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110095 (Pygl)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110095 (Pygl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110095 (Pygl)
   04922 Glucagon signaling pathway
    110095 (Pygl)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110095 (Pygl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     110095 (Pygl)
SSDB
Motif
Pfam: Phosphorylase DUF4181
Other DBs
NCBI-GeneID: 110095
NCBI-ProteinID: NP_573461
MGI: 97829
Ensembl: ENSMUSG00000021069
Vega: OTTMUSG00000025904
UniProt: Q9ET01
Position
12 C2; 12 29.01 cM
AA seq 850 aa
MAKPLTDQEKRRQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIREGWQVEEA
DDWLRHGNPWEKARPEFMLPVHFYGRVEHTQTGTKWVDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDVIRRFKASKFGSKDGMGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWAKAWEITKKTFAYTNHTVLPEALERWPVELVEKLLPRHLEIIYEINQKHLDRIVALFP
KDISRMRRMSLIEEEGGKRINMAHLCIVGCHAVNGVAKIHSDIVKTQVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFVSDDIFLREIAKVKQ
ENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDPKKFFV
PRTVIIGGKAAPGYHMAKMIIKLITSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQEKVSQLYMNQKAWNTMVLKNIAASGKFSSDRTIKEYAKDIWNMEPSDLKISLSNE
SSNGVSANGK
NT seq 2553 nt   +upstreamnt  +downstreamnt
atggcaaagcccctgaccgaccaggagaagcgacggcagatcagcatccgaggcatcgtg
ggcgtagagaatgtggccgagctgaaaaagggtttcaaccgtcacctgcacttcactctg
gtcaaggaccgcaatgtggccaccccccgcgactactacttcgcccttgcgcacacagtg
cgcgaccacctggtggggcgctggatccgtacacagcagcactactacgacaagtgtccc
aagagggtgtattacctctctctggaattttacatgggccgaacattacagaacaccatg
atcaaccttggcttacaaaatgcctgcgatgaggccatttaccagcttggattggacatg
gaagagttagaagaaattgaagaagatgccggccttggcaatggcggtcttgggaggctt
gctgcctgcttcctggactccatggcaaccctgggacttgcagcctatggctacggcatt
cgttatgaatacggaatcttcaatcagaagatccgagagggatggcaggtagaagaggca
gatgactggctcaggcatggaaacccttgggagaaggctcgccctgaattcatgctgccc
gtgcatttctacggaagagtagagcacacccagacggggacaaagtgggtcgacacccag
gtggtcctggctctgccttacgacacccccgtgcctggatatatgaacaacactgtgaac
actatgcgcctctggtcggctcgagcaccaaatgactttaaccttcaagattttaatgtt
ggagactacattcaggctgtgctggaccggaacctggctgagaatatctccagagtgctc
taccccaatgataacttctttgaagggaaggagttgcggctgaaacaggagtactttgtg
gtggctgccaccctgcaggatgtcatccggcgcttcaaggcctccaagttcggctccaag
gatggcatgggaaccgtgtttgatgcctttccagatcaggtagccatccagctgaatgac
acacatcctgcactcgccattccagagctgatgaggatttttgtggacattgaaaaactg
ccctgggccaaggcatgggagatcacgaagaagaccttcgcctacaccaaccacacggtg
ctcccggaggccctggagcgctggccggtggaactggtggagaagctgctgcctcgacac
ttggagatcatttatgagatcaatcagaaacatttagacagaattgtggccttgtttcct
aaagacatcagccgcatgcggagaatgtctctcattgaggaggaaggaggcaaacggatc
aacatggcccacctctgcatcgtgggctgccacgcggtgaacggtgtagcaaagatccac
tcggacatcgtgaagacccaagtattcaaggacttcagcgagctagaaccagacaagttc
cagaataaaaccaacgggattaccccgaggcgctggctcctactctgcaacccagggctg
gctgacttgatagcggagaaaattggagaggattatgtgaaagacctgagccagctgacg
aagctccacagttttgtgagtgatgacatcttcctccgggaaatagccaaagtgaaacag
gaaaataagctgaaattctcccagttcctggagaaggaatacaaggtgaagatcaaccca
tcctccatgtttgatgtccatgtgaagcggatccacgagtataaaaggcagcttctgaac
tgcctgcatgtgatcaccatgtacaatcgcatcaagaaagaccctaagaaattcttcgtg
ccaaggacagtcataattggtggcaaagctgccccaggatatcacatggccaaaatgatc
ataaagctgatcacctctgtggcagaagtggtgaacaatgaccccatggtcggcagcaag
ttgaaagtcatcttcttggagaactacagagtgtctcttgccgaaaaagtcattccagcc
acagacctatcggagcagatctccacggcaggcacggaagcctccgggacaggcaacatg
aagttcatgctgaacggggccctgaccatcgggactatggatggggccaatgtggagatg
gcagaggaagctggggaggagaacctgttcatctttggcatgagagtagatgatgtggct
gctttggataagaaggggtatgaggccaaagaatattacgaggcccttccagaactgaag
ttggtcatcgaccaaatcgacaatggcttcttttctcccaatcagccagacctcttcaaa
gacatcatcaacatgttattttatcatgacagatttaaagtctttgcagactacgaagcc
tatgtcaagtgtcaagaaaaagtcagtcagctgtatatgaatcaaaaagcctggaacaca
atggtactcaaaaacatagctgcctcagggaagttctccagtgaccgaacaattaaggag
tatgccaaggacatctggaacatggagccttcggatctgaagatttccctatccaacgag
tccagcaatggggtcagtgccaatgggaagtga

DBGET integrated database retrieval system