KEGG   Mus musculus (house mouse): 110109
Entry
110109            CDS       T01002                                 
Symbol
Nop2, 120kDa, A530002O17, Nol1
Name
(RefSeq) NOP2 nucleolar protein
  KO
K14835  25S rRNA (cytosine2870-C5)-methyltransferase [EC:2.1.1.310]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    110109 (Nop2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.310  25S rRNA (cytosine2870-C5)-methyltransferase
     110109 (Nop2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    110109 (Nop2)
SSDB
Motif
Pfam: Methyltr_RsmB-F P120R Methyltr_RsmF_N FtsJ Methyltransf_25 PCMT Methyltransf_31 Ubie_methyltran
Other DBs
NCBI-GeneID: 110109
NCBI-ProteinID: NP_620086
MGI: 107891
Ensembl: ENSMUSG00000038279
UniProt: E9QN31
Position
6:125108829..125121716
AA seq 794 aa
MGRKLDPTKKEKRGPGRKARKQKGAETELVRFLPAAGDENSKRLSSRARKRAAKRRAGSV
DVPKPNKSPGIKTLPGELSKGAVQARGKKRPAPIQNSDGDEEEDSGEDDVVTQGDLWGSE
DSDEDMVDDYGAASNSEDEEEKLLPIERAALKQKAQDATAGVLWNEEDTDEDEDDDGVSP
ESHPRKDDKAEGDLQINVEDEEAFVLPPAGETDQDGQAPDLQRVHKRIQDIVGVLRDFGA
QREEGRSRAEYLSRLQKDLATYYSYGDFLLSKLMELFPLSELIEFLEANEVPRPITLRTN
TLKTRRRDLAQALINRGVNLDPLGKWSKSGLVVYDSSVPIGATPEYLAGHYMLQGASSML
PVMALAPQEHERILDMCCAPGGKTSYIAQLMKNTGVILANDANADRLKSVVGNLHRLGVT
NTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDIQRCAHLQKELL
LSAIDSVNAASKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFQ
ARRFHPTLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQPHAGNSAAATPTEPDLKDQVTP
KSENGSQPTKKARGAVKAKQQLLRQPHSKKPFQKLNGIAKGPGLSTEPSVPDAQVSTRPS
QSAGNADVNSKRKRSEKLKQRGPKWKPSKEAAVPKPSAPSRVEDSRTPPVPTPSEIRAAP
RPKDCAPSLGEAKKKQKGKQQLAQQPANGAAPLKEDAVSKGPSAPFVSPHSSTRPPPAKR
RKSMTKGNSQPLLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggggcgcaagttggatcctacgaagaaggagaagcgtggacccggccgaaaggcccga
aaacagaagggtgcggagaccgaattggtcagatttttgcctgcagctggcgatgagaat
tccaagaggctgtcgagtcgtgcccgaaagcgggcagccaagaggagggcagggtctgtt
gacgtccctaagccaaataagtctcctgggatcaaaacattgcctggagagttatccaaa
ggagcagtccaggctcgaggtaagaagcgcccagcaccaattcaaaacagtgatggggac
gaggaggaagactcgggggaagacgatgtggtgacccagggggacctttggggctctgag
gacagtgatgaagatatggtggatgactatggagctgcctctaactcggaggatgaggag
gaaaagctgttgcctattgaaagagctgccctgaagcagaaagcccaggatgccacagct
ggggtcctgtggaatgaagaggacactgatgaagatgaagatgatgatggtgtgtcccct
gagtcccaccccagaaaggatgacaaagcagagggggatttgcagattaatgtggaagat
gaggaagcctttgtgctgccccctgctggggagacggaccaggatggccaggctccagac
ctgcagcgagttcacaagcggatccaggacatcgtgggagtgctgcgggatttcggagct
cagcgagaagagggccggtctcgagctgagtatctaagtcggcttcagaaggacctggcc
acttactattcttatggagacttcctgctgagcaagctcatggagctgttccctctgtct
gagttgatcgagttcttagaagctaatgaggtgccccggccaatcacccttcggaccaac
accttgaaaacccgtcgccgagaccttgctcaggctctgatcaatcgtggggttaatctg
gatccactggggaagtggtcaaagtctggacttgtggtatatgattcttcagtgcctatt
ggcgctacccctgagtacctcgctggacactatatgctgcagggagcttccagtatgttg
cccgtcatggccctggcacctcaggagcatgagcggatcttagacatgtgctgtgctcct
ggggggaagaccagctacatagctcagctgatgaagaacacaggagtgatccttgccaac
gatgccaatgcagaccggctcaagagcgtggtgggcaacctgcaccgcttgggagtcacc
aacaccatcatcagccactatgatgggcgccagttccccaaggtggtagggggctttgat
cgagtgctactggatgctccttgtagtggcacaggagtcatctccaaagaccctgctgtg
aagacgaacaaggatgagaaagacatccagcgctgtgcccaccttcagaaggaactgctg
ctcagtgctatcgactcagtgaacgctgcctccaagaccggaggctacctggtctactgc
acctgttccattacggtggaagagaacgagtgggtggtagactatgccttgaagaagagg
aatgtgcggctggtgcccaccggcctggacttcggccaggaaggttttacccgcttccaa
gcaaggcgctttcaccccactctgcgttccacccggcgcttctaccctcacactcacaat
atggacggtttctttatcgccaagttcaagaaattttccaattctattccccagccccat
gcaggaaactcggcagcagctacccctacagagcctgacctgaaggatcaggtcacccca
aagtctgagaacggtagtcagcccaccaagaaagcccgtggggctgtgaaggcaaagcag
cagttgctgagacagccacattccaagaagcccttccagaagttgaacggcatcgccaaa
gggccaggcttgtccactgaaccttctgtcccagatgcccaagtgtctaccaggcccagt
cagtctgctgggaatgctgacgtgaacagcaaacgaaagaggtctgagaagctgaagcag
cggggacctaagtggaagccctctaaggaggctgctgtcccaaagccgagcgccccttcc
agggttgaggactcgagaacacctcctgtgccgactccctctgaaatccgtgctgcccca
aggcctaaggactgtgctccatcccttggggaagccaaaaagaaacagaaaggaaagcag
cagttagcacagcagcctgctaatggagctgctcccctgaaagaagatgctgtttccaag
ggaccctcagccccctttgtgtctccccacagttccaccaggcccccaccagcaaaaagg
aggaaatcaatgacaaagggcaacagccagcctctgttgtcttaa

DBGET integrated database retrieval system